Detailed information of TA system
Overview
TA module
| Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
| Location | 2924237..2925036 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | hepT | Uniprot ID | A0A7T5U992 |
| Locus tag | O1Q74_RS13560 | Protein ID | WP_039535340.1 |
| Coordinates | 2924617..2925036 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | mntA | Uniprot ID | - |
| Locus tag | O1Q74_RS13555 | Protein ID | WP_271873805.1 |
| Coordinates | 2924237..2924620 (+) | Length | 128 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS13540 (O1Q74_13540) | 2919539..2920675 | - | 1137 | WP_271873801.1 | polysaccharide export protein | - |
| O1Q74_RS13545 (O1Q74_13545) | 2920801..2921880 | - | 1080 | WP_271873802.1 | UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase | - |
| O1Q74_RS13550 (O1Q74_13550) | 2922537..2924123 | + | 1587 | WP_271873803.1 | TerC family protein | - |
| O1Q74_RS13555 (O1Q74_13555) | 2924237..2924620 | + | 384 | WP_271873805.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
| O1Q74_RS13560 (O1Q74_13560) | 2924617..2925036 | + | 420 | WP_039535340.1 | DUF86 domain-containing protein | Toxin |
| O1Q74_RS13565 (O1Q74_13565) | 2925080..2926426 | - | 1347 | WP_271873807.1 | anaerobic C4-dicarboxylate transporter DcuC | - |
| O1Q74_RS13570 (O1Q74_13570) | 2926726..2928561 | - | 1836 | WP_271873808.1 | outer membrane assembly protein AsmA | - |
| O1Q74_RS13575 (O1Q74_13575) | 2928654..2929235 | - | 582 | WP_015839565.1 | dCTP deaminase | - |
| O1Q74_RS13580 (O1Q74_13580) | 2929360..2930001 | - | 642 | WP_015839564.1 | uridine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16038.34 Da Isoelectric Point: 6.9682
>T268726 WP_039535340.1 NZ_CP116477:2924617-2925036 [Pectobacterium sp. A5351]
MTDILLNKSSTIQRCLRRIREEFDTEEGFRQNFTKQDSVILNIQRACEAAIDIANYLIRIKQLGIPQSSRDSFALLAANQ
IITVDLSDNLQKMVGLRNIAVHDYQALNLDIVIHVISHRLSDFEHFIKQIARYSDSQHL
MTDILLNKSSTIQRCLRRIREEFDTEEGFRQNFTKQDSVILNIQRACEAAIDIANYLIRIKQLGIPQSSRDSFALLAANQ
IITVDLSDNLQKMVGLRNIAVHDYQALNLDIVIHVISHRLSDFEHFIKQIARYSDSQHL
Download Length: 420 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 14371.63 Da Isoelectric Point: 5.2044
>AT268726 WP_271873805.1 NZ_CP116477:2924237-2924620 [Pectobacterium sp. A5351]
MFDKIVLTLKKQMPDIKIIYLFGSQATGNARADSDIDIAIMATRALDPVKRWELSNQLAKEVGHDVDLIDLLQASTVLKM
EIVRNGKLLYDAETAAGEFEMTTLSMYQHLQKERADIIRSFNQDLKA
MFDKIVLTLKKQMPDIKIIYLFGSQATGNARADSDIDIAIMATRALDPVKRWELSNQLAKEVGHDVDLIDLLQASTVLKM
EIVRNGKLLYDAETAAGEFEMTTLSMYQHLQKERADIIRSFNQDLKA
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|