Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2638684..2639237 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | O1Q74_RS12355 | Protein ID | WP_271873538.1 |
Coordinates | 2638684..2638998 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A3S1FM98 |
Locus tag | O1Q74_RS12360 | Protein ID | WP_029729596.1 |
Coordinates | 2639001..2639237 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS12325 (O1Q74_12325) | 2634242..2634514 | - | 273 | WP_271873534.1 | hypothetical protein | - |
O1Q74_RS12330 (O1Q74_12330) | 2634730..2636118 | - | 1389 | WP_271873535.1 | ATP-binding protein | - |
O1Q74_RS12335 (O1Q74_12335) | 2636118..2636795 | - | 678 | WP_271873536.1 | response regulator | - |
O1Q74_RS12340 (O1Q74_12340) | 2637000..2637836 | + | 837 | WP_271873537.1 | MipA/OmpV family protein | - |
O1Q74_RS12345 (O1Q74_12345) | 2638023..2638205 | - | 183 | Protein_2390 | IS630 family transposase | - |
O1Q74_RS12350 (O1Q74_12350) | 2638255..2638650 | + | 396 | Protein_2391 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
O1Q74_RS12355 (O1Q74_12355) | 2638684..2638998 | - | 315 | WP_271873538.1 | CcdB family protein | Toxin |
O1Q74_RS12360 (O1Q74_12360) | 2639001..2639237 | - | 237 | WP_029729596.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
O1Q74_RS12365 (O1Q74_12365) | 2639419..2639535 | + | 117 | Protein_2394 | IS110 family transposase | - |
O1Q74_RS12370 (O1Q74_12370) | 2640010..2640726 | + | 717 | WP_271873539.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
O1Q74_RS12375 (O1Q74_12375) | 2640872..2642029 | - | 1158 | Protein_2396 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2630708..2649633 | 18925 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11549.50 Da Isoelectric Point: 7.9859
>T268725 WP_271873538.1 NZ_CP116477:c2638998-2638684 [Pectobacterium sp. A5351]
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPERLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAALDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPERLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAALDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|