Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2628306..2628859 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | O1Q74_RS12295 | Protein ID | WP_029729595.1 |
Coordinates | 2628306..2628620 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A3S1FM98 |
Locus tag | O1Q74_RS12300 | Protein ID | WP_029729596.1 |
Coordinates | 2628623..2628859 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS12260 (O1Q74_12260) | 2623484..2624734 | + | 1251 | WP_271873521.1 | integrase domain-containing protein | - |
O1Q74_RS12265 (O1Q74_12265) | 2625001..2625216 | + | 216 | WP_224717866.1 | AlpA family phage regulatory protein | - |
O1Q74_RS12270 (O1Q74_12270) | 2625356..2625547 | - | 192 | WP_014915000.1 | YlcI/YnfO family protein | - |
O1Q74_RS12275 (O1Q74_12275) | 2625612..2626094 | + | 483 | WP_271873526.1 | transposase | - |
O1Q74_RS12280 (O1Q74_12280) | 2626130..2626423 | + | 294 | WP_271873528.1 | helix-turn-helix domain-containing protein | - |
O1Q74_RS12285 (O1Q74_12285) | 2626468..2627618 | + | 1151 | Protein_2378 | IS3 family transposase | - |
O1Q74_RS12290 (O1Q74_12290) | 2627636..2627860 | + | 225 | WP_271873529.1 | DUF4326 domain-containing protein | - |
O1Q74_RS12295 (O1Q74_12295) | 2628306..2628620 | - | 315 | WP_029729595.1 | CcdB family protein | Toxin |
O1Q74_RS12300 (O1Q74_12300) | 2628623..2628859 | - | 237 | WP_029729596.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
O1Q74_RS12305 (O1Q74_12305) | 2629178..2630122 | - | 945 | WP_271873530.1 | zincin-like metallopeptidase domain-containing protein | - |
O1Q74_RS12310 (O1Q74_12310) | 2630708..2632411 | - | 1704 | WP_271873531.1 | DUF2326 domain-containing protein | - |
O1Q74_RS12315 (O1Q74_12315) | 2632638..2633228 | - | 591 | WP_271873532.1 | hypothetical protein | - |
O1Q74_RS12320 (O1Q74_12320) | 2633221..2633472 | - | 252 | WP_271873533.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11591.54 Da Isoelectric Point: 7.9874
>T268724 WP_029729595.1 NZ_CP116477:c2628620-2628306 [Pectobacterium sp. A5351]
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIERYPAGRRPERLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQIKAAIDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIERYPAGRRPERLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQIKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|