Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 913455..913981 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | O1Q74_RS04360 | Protein ID | WP_271876359.1 |
Coordinates | 913455..913760 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | O1Q74_RS04365 | Protein ID | WP_271876362.1 |
Coordinates | 913763..913981 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS04350 (O1Q74_04345) | 910059..912068 | + | 2010 | WP_271876356.1 | helicase-related protein | - |
O1Q74_RS04355 (O1Q74_04350) | 912070..913329 | + | 1260 | WP_271876357.1 | GIY-YIG nuclease family protein | - |
O1Q74_RS04360 (O1Q74_04355) | 913455..913760 | - | 306 | WP_271876359.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
O1Q74_RS04365 (O1Q74_04360) | 913763..913981 | - | 219 | WP_271876362.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
O1Q74_RS04370 (O1Q74_04365) | 914040..914783 | - | 744 | WP_271876364.1 | MobC family replication-relaxation protein | - |
O1Q74_RS04375 (O1Q74_04370) | 915206..915547 | - | 342 | WP_271876367.1 | hypothetical protein | - |
O1Q74_RS04380 (O1Q74_04375) | 915687..915857 | + | 171 | WP_271876369.1 | hypothetical protein | - |
O1Q74_RS04385 (O1Q74_04380) | 915999..917257 | - | 1259 | Protein_839 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 901087..917425 | 16338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11722.61 Da Isoelectric Point: 4.8450
>T268722 WP_271876359.1 NZ_CP116477:c913760-913455 [Pectobacterium sp. A5351]
MQFIVYQHKITSHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGEVI
ADLGDYADEIKDAINLMFWGI
MQFIVYQHKITSHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGEVI
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|