Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 889421..889947 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | O1Q74_RS04240 | Protein ID | WP_271876320.1 |
Coordinates | 889421..889726 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | O1Q74_RS04245 | Protein ID | WP_271876323.1 |
Coordinates | 889729..889947 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS04215 (O1Q74_04210) | 885293..885919 | + | 627 | WP_271876313.1 | protein-L-isoaspartate(D-aspartate) O-methyltransferase | - |
O1Q74_RS04220 (O1Q74_04215) | 886344..887366 | + | 1023 | WP_271876315.1 | murein hydrolase activator NlpD | - |
O1Q74_RS04225 (O1Q74_04220) | 887420..888412 | + | 993 | WP_271876317.1 | RNA polymerase sigma factor RpoS | - |
O1Q74_RS04230 (O1Q74_04225) | 888522..888793 | - | 272 | Protein_808 | IS3 family transposase | - |
O1Q74_RS04235 (O1Q74_04230) | 888840..889307 | + | 468 | Protein_809 | transposase | - |
O1Q74_RS04240 (O1Q74_04235) | 889421..889726 | - | 306 | WP_271876320.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
O1Q74_RS04245 (O1Q74_04240) | 889729..889947 | - | 219 | WP_271876323.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
O1Q74_RS04250 (O1Q74_04245) | 890006..890230 | - | 225 | Protein_812 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
O1Q74_RS04255 (O1Q74_04250) | 890300..890733 | + | 434 | Protein_813 | IS5 family transposase | - |
O1Q74_RS04260 (O1Q74_04255) | 890913..892417 | + | 1505 | Protein_814 | type IV conjugative transfer system coupling protein TraD | - |
O1Q74_RS04265 (O1Q74_04260) | 892417..892881 | + | 465 | WP_271876325.1 | DUF4400 domain-containing protein | - |
O1Q74_RS04270 (O1Q74_04265) | 893057..893188 | + | 132 | WP_258305550.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11839.76 Da Isoelectric Point: 5.1199
>T268721 WP_271876320.1 NZ_CP116477:c889726-889421 [Pectobacterium sp. A5351]
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPFIESHHLSEKVNKTLFPLIRINDEDYRLMTTELSSVPVEVMGEVI
ADLSDCANEIKDAINLMFWGI
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPFIESHHLSEKVNKTLFPLIRINDEDYRLMTTELSSVPVEVMGEVI
ADLSDCANEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|