Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 781523..782084 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | O1Q74_RS03755 | Protein ID | WP_271876190.1 |
| Coordinates | 781523..781819 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | O1Q74_RS03760 | Protein ID | WP_271876191.1 |
| Coordinates | 781803..782084 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS03725 (O1Q74_03720) | 776559..776909 | + | 351 | WP_271876183.1 | phage GP46 family protein | - |
| O1Q74_RS03730 (O1Q74_03725) | 776909..777970 | + | 1062 | WP_271876185.1 | baseplate J/gp47 family protein | - |
| O1Q74_RS03735 (O1Q74_03730) | 777967..778539 | + | 573 | WP_271876187.1 | DUF2313 domain-containing protein | - |
| O1Q74_RS03740 (O1Q74_03735) | 778542..780248 | + | 1707 | WP_271876188.1 | phage tail protein | - |
| O1Q74_RS03745 (O1Q74_03740) | 780248..780862 | + | 615 | WP_271876189.1 | tail fiber assembly protein | - |
| O1Q74_RS03750 (O1Q74_03745) | 781370..781498 | - | 129 | WP_225088216.1 | entericidin A/B family lipoprotein | - |
| O1Q74_RS03755 (O1Q74_03750) | 781523..781819 | - | 297 | WP_271876190.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| O1Q74_RS03760 (O1Q74_03755) | 781803..782084 | - | 282 | WP_271876191.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| O1Q74_RS03765 (O1Q74_03760) | 782125..782412 | - | 288 | WP_271876192.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O1Q74_RS03770 (O1Q74_03765) | 782363..782623 | - | 261 | WP_271876193.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| O1Q74_RS03775 (O1Q74_03770) | 782850..783992 | - | 1143 | WP_271876194.1 | radical SAM family heme chaperone HemW | - |
| O1Q74_RS03780 (O1Q74_03775) | 783985..784578 | - | 594 | WP_271876195.1 | XTP/dITP diphosphatase | - |
| O1Q74_RS03785 (O1Q74_03780) | 784610..784900 | - | 291 | WP_271876196.1 | DUF167 family protein YggU | - |
| O1Q74_RS03790 (O1Q74_03785) | 784897..785451 | - | 555 | WP_010295003.1 | YggT family protein | - |
| O1Q74_RS03795 (O1Q74_03790) | 785500..786321 | - | 822 | WP_271876197.1 | pyrroline-5-carboxylate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11556.29 Da Isoelectric Point: 9.0452
>T268720 WP_271876190.1 NZ_CP116477:c781819-781523 [Pectobacterium sp. A5351]
MTRKIERSTEFKKDYKREKKGRHCRTVEADLLVLLNILANDLPISANYVDHPLRGNWRSFRDCHLYPDLILIYKKINNEE
DDSGILKLARLGSHSELF
MTRKIERSTEFKKDYKREKKGRHCRTVEADLLVLLNILANDLPISANYVDHPLRGNWRSFRDCHLYPDLILIYKKINNEE
DDSGILKLARLGSHSELF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|