Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 781523..782084 Replicon chromosome
Accession NZ_CP116477
Organism Pectobacterium sp. A5351

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag O1Q74_RS03755 Protein ID WP_271876190.1
Coordinates 781523..781819 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag O1Q74_RS03760 Protein ID WP_271876191.1
Coordinates 781803..782084 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O1Q74_RS03725 (O1Q74_03720) 776559..776909 + 351 WP_271876183.1 phage GP46 family protein -
O1Q74_RS03730 (O1Q74_03725) 776909..777970 + 1062 WP_271876185.1 baseplate J/gp47 family protein -
O1Q74_RS03735 (O1Q74_03730) 777967..778539 + 573 WP_271876187.1 DUF2313 domain-containing protein -
O1Q74_RS03740 (O1Q74_03735) 778542..780248 + 1707 WP_271876188.1 phage tail protein -
O1Q74_RS03745 (O1Q74_03740) 780248..780862 + 615 WP_271876189.1 tail fiber assembly protein -
O1Q74_RS03750 (O1Q74_03745) 781370..781498 - 129 WP_225088216.1 entericidin A/B family lipoprotein -
O1Q74_RS03755 (O1Q74_03750) 781523..781819 - 297 WP_271876190.1 type II toxin-antitoxin system YafQ family toxin Toxin
O1Q74_RS03760 (O1Q74_03755) 781803..782084 - 282 WP_271876191.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O1Q74_RS03765 (O1Q74_03760) 782125..782412 - 288 WP_271876192.1 type II toxin-antitoxin system RelE/ParE family toxin -
O1Q74_RS03770 (O1Q74_03765) 782363..782623 - 261 WP_271876193.1 type II toxin-antitoxin system ParD family antitoxin -
O1Q74_RS03775 (O1Q74_03770) 782850..783992 - 1143 WP_271876194.1 radical SAM family heme chaperone HemW -
O1Q74_RS03780 (O1Q74_03775) 783985..784578 - 594 WP_271876195.1 XTP/dITP diphosphatase -
O1Q74_RS03785 (O1Q74_03780) 784610..784900 - 291 WP_271876196.1 DUF167 family protein YggU -
O1Q74_RS03790 (O1Q74_03785) 784897..785451 - 555 WP_010295003.1 YggT family protein -
O1Q74_RS03795 (O1Q74_03790) 785500..786321 - 822 WP_271876197.1 pyrroline-5-carboxylate reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-98)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-87)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11556.29 Da        Isoelectric Point: 9.0452

>T268720 WP_271876190.1 NZ_CP116477:c781819-781523 [Pectobacterium sp. A5351]
MTRKIERSTEFKKDYKREKKGRHCRTVEADLLVLLNILANDLPISANYVDHPLRGNWRSFRDCHLYPDLILIYKKINNEE
DDSGILKLARLGSHSELF

Download         Length: 297 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10291.76 Da        Isoelectric Point: 5.8506

>AT268720 WP_271876191.1 NZ_CP116477:c782084-781803 [Pectobacterium sp. A5351]
MATETYVRAKIDPKTKALATVALESMGLTVSDAIRLLMVQVAEKNELPFKVKGANYINARRTKAAINQLEHGRGKQFDNV
AALMDDLNNDEED

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References