Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 668869..669529 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | O1Q74_RS03125 | Protein ID | WP_271876037.1 |
Coordinates | 669155..669529 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | C6D8Y5 |
Locus tag | O1Q74_RS03120 | Protein ID | WP_012773340.1 |
Coordinates | 668869..669135 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS03100 (O1Q74_03100) | 664885..665889 | - | 1005 | WP_271876033.1 | LacI family DNA-binding transcriptional regulator | - |
O1Q74_RS03105 (O1Q74_03105) | 665944..666552 | - | 609 | WP_271876034.1 | HD domain-containing protein | - |
O1Q74_RS03110 (O1Q74_03110) | 666931..667578 | + | 648 | WP_271876035.1 | hemolysin III family protein | - |
O1Q74_RS03115 (O1Q74_03115) | 667632..668633 | - | 1002 | WP_271876036.1 | tRNA-modifying protein YgfZ | - |
O1Q74_RS03120 (O1Q74_03120) | 668869..669135 | + | 267 | WP_012773340.1 | FAD assembly factor SdhE | Antitoxin |
O1Q74_RS03125 (O1Q74_03125) | 669155..669529 | + | 375 | WP_271876037.1 | protein YgfX | Toxin |
O1Q74_RS03130 (O1Q74_03130) | 669598..670533 | + | 936 | WP_271876038.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
O1Q74_RS03135 (O1Q74_03135) | 670583..670906 | - | 324 | WP_271876039.1 | hypothetical protein | - |
O1Q74_RS03140 (O1Q74_03140) | 670935..671453 | - | 519 | WP_271876040.1 | flavodoxin FldB | - |
O1Q74_RS03145 (O1Q74_03145) | 671615..672940 | - | 1326 | WP_271876041.1 | MFS transporter | - |
O1Q74_RS03150 (O1Q74_03150) | 673252..674151 | + | 900 | WP_271876042.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14737.42 Da Isoelectric Point: 10.7139
>T268719 WP_271876037.1 NZ_CP116477:669155-669529 [Pectobacterium sp. A5351]
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQTVNGKDRQQLWLASDSMGNDEWRHLRQLLLQQKYWAR
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQTVNGKDRQQLWLASDSMGNDEWRHLRQLLLQQKYWAR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|