Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
Location | 342321..342852 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | O1Q74_RS01615 | Protein ID | WP_271875811.1 |
Coordinates | 342565..342852 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | - |
Locus tag | O1Q74_RS01610 | Protein ID | WP_180778477.1 |
Coordinates | 342321..342575 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS01585 (O1Q74_01585) | 337436..338026 | - | 591 | WP_005975525.1 | DnaA initiator-associating protein DiaA | - |
O1Q74_RS01590 (O1Q74_01590) | 338067..338423 | - | 357 | WP_271878699.1 | YraN family protein | - |
O1Q74_RS01595 (O1Q74_01595) | 338420..340438 | - | 2019 | WP_271875809.1 | penicillin-binding protein activator | - |
O1Q74_RS01600 (O1Q74_01600) | 340500..341387 | + | 888 | WP_271875810.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
O1Q74_RS01610 (O1Q74_01610) | 342321..342575 | + | 255 | WP_180778477.1 | plasmid stabilization protein | Antitoxin |
O1Q74_RS01615 (O1Q74_01615) | 342565..342852 | + | 288 | WP_271875811.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O1Q74_RS01620 (O1Q74_01620) | 343031..343816 | + | 786 | WP_271875812.1 | 4,5-DOPA dioxygenase extradiol | - |
O1Q74_RS01625 (O1Q74_01625) | 343886..345046 | - | 1161 | WP_180778474.1 | glutathionylspermidine synthase family protein | - |
O1Q74_RS01630 (O1Q74_01630) | 345057..345731 | - | 675 | WP_010297420.1 | DUF1190 family protein | - |
O1Q74_RS01635 (O1Q74_01635) | 345996..347390 | - | 1395 | WP_271875813.1 | outer membrane channel protein TolC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10992.92 Da Isoelectric Point: 10.7694
>T268715 WP_271875811.1 NZ_CP116477:342565-342852 [Pectobacterium sp. A5351]
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLAERLEHPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQVYSDTKGRSA
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLAERLEHPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQVYSDTKGRSA
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|