Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 182225..182842 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | C6DHN3 |
| Locus tag | O1Q74_RS00850 | Protein ID | WP_010281507.1 |
| Coordinates | 182663..182842 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O1Q74_RS00845 | Protein ID | WP_271875598.1 |
| Coordinates | 182225..182635 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS00830 (O1Q74_00830) | 178084..179127 | - | 1044 | WP_271875595.1 | DNA-binding transcriptional regulator CytR | - |
| O1Q74_RS00835 (O1Q74_00835) | 179416..181614 | - | 2199 | WP_271875596.1 | primosomal protein N' | - |
| O1Q74_RS00840 (O1Q74_00840) | 181928..182143 | + | 216 | WP_012772907.1 | 50S ribosomal protein L31 | - |
| O1Q74_RS00845 (O1Q74_00845) | 182225..182635 | - | 411 | WP_271875598.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| O1Q74_RS00850 (O1Q74_00850) | 182663..182842 | - | 180 | WP_010281507.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| O1Q74_RS00855 (O1Q74_00855) | 182941..183951 | - | 1011 | WP_271875603.1 | iron ABC transporter permease | - |
| O1Q74_RS00860 (O1Q74_00860) | 183948..184910 | - | 963 | WP_271875605.1 | ABC transporter substrate-binding protein | - |
| O1Q74_RS00865 (O1Q74_00865) | 184920..185717 | - | 798 | WP_271875606.1 | ABC transporter ATP-binding protein | - |
| O1Q74_RS00870 (O1Q74_00870) | 185936..186253 | - | 318 | WP_005973355.1 | met regulon transcriptional regulator MetJ | - |
| O1Q74_RS00875 (O1Q74_00875) | 186441..187601 | + | 1161 | WP_271875614.1 | cystathionine gamma-synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6560.69 Da Isoelectric Point: 10.7838
>T268714 WP_010281507.1 NZ_CP116477:c182842-182663 [Pectobacterium sp. A5351]
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14536.41 Da Isoelectric Point: 4.3391
>AT268714 WP_271875598.1 NZ_CP116477:c182635-182225 [Pectobacterium sp. A5351]
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAITGHIELLIEMGQDIPTVSSVGQLAKSAEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSSR
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAITGHIELLIEMGQDIPTVSSVGQLAKSAEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSSR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|