Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 1862369..1863042 | Replicon | chromosome |
Accession | NZ_CP116458 | ||
Organism | Acidithiobacillus ferriphilus strain YL25 |
Toxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PJU76_RS09385 | Protein ID | WP_271779317.1 |
Coordinates | 1862369..1862791 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PJU76_RS09390 | Protein ID | WP_271779318.1 |
Coordinates | 1862788..1863042 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJU76_RS09360 (PJU76_09360) | 1858120..1858326 | - | 207 | WP_271779312.1 | hypothetical protein | - |
PJU76_RS09365 (PJU76_09365) | 1858454..1858780 | - | 327 | WP_271779313.1 | EAL domain-containing protein | - |
PJU76_RS09370 (PJU76_09370) | 1859087..1860127 | + | 1041 | WP_271779314.1 | extracellular solute-binding protein | - |
PJU76_RS09375 (PJU76_09375) | 1860225..1861553 | + | 1329 | WP_271779315.1 | hypothetical protein | - |
PJU76_RS09380 (PJU76_09380) | 1861692..1861898 | + | 207 | WP_271779316.1 | TOBE domain-containing protein | - |
PJU76_RS09385 (PJU76_09385) | 1862369..1862791 | - | 423 | WP_271779317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PJU76_RS09390 (PJU76_09390) | 1862788..1863042 | - | 255 | WP_271779318.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PJU76_RS09395 (PJU76_09395) | 1863354..1867472 | + | 4119 | WP_271779319.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15439.84 Da Isoelectric Point: 6.4788
>T268712 WP_271779317.1 NZ_CP116458:c1862791-1862369 [Acidithiobacillus ferriphilus]
VRYLLDTCVLSELVKKHPDPRVVTWVDAREAVGFLSVLTLGELQKGVAKLVDGDKRSMLQDWIDVDLRGRFVGRILPVNE
HIASAWGGITGAAEQRGEKLPAIDSLLAATALVHHLTVATRNIVDLQRCQVPVVDPWDQT
VRYLLDTCVLSELVKKHPDPRVVTWVDAREAVGFLSVLTLGELQKGVAKLVDGDKRSMLQDWIDVDLRGRFVGRILPVNE
HIASAWGGITGAAEQRGEKLPAIDSLLAATALVHHLTVATRNIVDLQRCQVPVVDPWDQT
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|