Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 1697254..1697900 Replicon chromosome
Accession NZ_CP116458
Organism Acidithiobacillus ferriphilus strain YL25

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PJU76_RS08610 Protein ID WP_271781003.1
Coordinates 1697502..1697900 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A179BNW7
Locus tag PJU76_RS08605 Protein ID WP_064218244.1
Coordinates 1697254..1697490 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PJU76_RS08590 (PJU76_08590) 1692297..1694837 + 2541 WP_271779188.1 DNA mismatch repair protein MutS -
PJU76_RS08595 (PJU76_08595) 1695088..1695618 + 531 WP_271779189.1 DedA family protein -
PJU76_RS08600 (PJU76_08600) 1695791..1696591 + 801 WP_271779190.1 DUF2628 domain-containing protein -
PJU76_RS08605 (PJU76_08605) 1697254..1697490 + 237 WP_064218244.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PJU76_RS08610 (PJU76_08610) 1697502..1697900 + 399 WP_271781003.1 type II toxin-antitoxin system VapC family toxin Toxin
PJU76_RS08615 (PJU76_08615) 1697970..1698128 - 159 WP_215849165.1 hypothetical protein -
PJU76_RS08620 (PJU76_08620) 1698333..1698557 + 225 WP_271779191.1 hypothetical protein -
PJU76_RS08625 (PJU76_08625) 1698619..1698888 + 270 WP_271779192.1 hypothetical protein -
PJU76_RS08630 (PJU76_08630) 1698885..1699808 - 924 WP_271779193.1 LysR family transcriptional regulator -
PJU76_RS08635 (PJU76_08635) 1700186..1700647 + 462 WP_271779194.1 globin domain-containing protein -
PJU76_RS08640 (PJU76_08640) 1700711..1701694 + 984 WP_271779195.1 FAD-binding oxidoreductase -
PJU76_RS08645 (PJU76_08645) 1701713..1701958 - 246 WP_215849168.1 thioredoxin family protein -
PJU76_RS08650 (PJU76_08650) 1702063..1702521 + 459 WP_271779196.1 hemerythrin domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-118)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14336.37 Da        Isoelectric Point: 4.6412

>T268710 WP_271781003.1 NZ_CP116458:1697502-1697900 [Acidithiobacillus ferriphilus]
MLDTNMCIYLIKHQPEKVAQRFAQCYVGDVVMSAITYAELEYGVAVSADPDRERANLAALTEDIPVITFDALAGVAYGPI
RQATSESKRDALDKLIAAHAVALGVTIVTNNTRDFAKYPGVMIENWLSSGAQ

Download         Length: 399 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8913.92 Da        Isoelectric Point: 5.7066

>AT268710 WP_064218244.1 NZ_CP116458:1697254-1697490 [Acidithiobacillus ferriphilus]
MHTTRVFKNGNSQAVRIPADLAYERSDIEVEIEREGDEIRIRPAHRPLAGVLSKFARFSPNFMADGRGDQEQTERDTL

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A179BNW7

References