Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 1697254..1697900 | Replicon | chromosome |
| Accession | NZ_CP116458 | ||
| Organism | Acidithiobacillus ferriphilus strain YL25 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PJU76_RS08610 | Protein ID | WP_271781003.1 |
| Coordinates | 1697502..1697900 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A179BNW7 |
| Locus tag | PJU76_RS08605 | Protein ID | WP_064218244.1 |
| Coordinates | 1697254..1697490 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJU76_RS08590 (PJU76_08590) | 1692297..1694837 | + | 2541 | WP_271779188.1 | DNA mismatch repair protein MutS | - |
| PJU76_RS08595 (PJU76_08595) | 1695088..1695618 | + | 531 | WP_271779189.1 | DedA family protein | - |
| PJU76_RS08600 (PJU76_08600) | 1695791..1696591 | + | 801 | WP_271779190.1 | DUF2628 domain-containing protein | - |
| PJU76_RS08605 (PJU76_08605) | 1697254..1697490 | + | 237 | WP_064218244.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PJU76_RS08610 (PJU76_08610) | 1697502..1697900 | + | 399 | WP_271781003.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PJU76_RS08615 (PJU76_08615) | 1697970..1698128 | - | 159 | WP_215849165.1 | hypothetical protein | - |
| PJU76_RS08620 (PJU76_08620) | 1698333..1698557 | + | 225 | WP_271779191.1 | hypothetical protein | - |
| PJU76_RS08625 (PJU76_08625) | 1698619..1698888 | + | 270 | WP_271779192.1 | hypothetical protein | - |
| PJU76_RS08630 (PJU76_08630) | 1698885..1699808 | - | 924 | WP_271779193.1 | LysR family transcriptional regulator | - |
| PJU76_RS08635 (PJU76_08635) | 1700186..1700647 | + | 462 | WP_271779194.1 | globin domain-containing protein | - |
| PJU76_RS08640 (PJU76_08640) | 1700711..1701694 | + | 984 | WP_271779195.1 | FAD-binding oxidoreductase | - |
| PJU76_RS08645 (PJU76_08645) | 1701713..1701958 | - | 246 | WP_215849168.1 | thioredoxin family protein | - |
| PJU76_RS08650 (PJU76_08650) | 1702063..1702521 | + | 459 | WP_271779196.1 | hemerythrin domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14336.37 Da Isoelectric Point: 4.6412
>T268710 WP_271781003.1 NZ_CP116458:1697502-1697900 [Acidithiobacillus ferriphilus]
MLDTNMCIYLIKHQPEKVAQRFAQCYVGDVVMSAITYAELEYGVAVSADPDRERANLAALTEDIPVITFDALAGVAYGPI
RQATSESKRDALDKLIAAHAVALGVTIVTNNTRDFAKYPGVMIENWLSSGAQ
MLDTNMCIYLIKHQPEKVAQRFAQCYVGDVVMSAITYAELEYGVAVSADPDRERANLAALTEDIPVITFDALAGVAYGPI
RQATSESKRDALDKLIAAHAVALGVTIVTNNTRDFAKYPGVMIENWLSSGAQ
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|