Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1326274..1326938 | Replicon | chromosome |
| Accession | NZ_CP116458 | ||
| Organism | Acidithiobacillus ferriphilus strain YL25 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PJU76_RS06615 | Protein ID | WP_271780974.1 |
| Coordinates | 1326507..1326938 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PJU76_RS06610 | Protein ID | WP_271780973.1 |
| Coordinates | 1326274..1326507 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJU76_RS06595 (PJU76_06595) | 1323663..1325132 | + | 1470 | WP_271780970.1 | DNA-3-methyladenine glycosylase 2 | - |
| PJU76_RS06600 (PJU76_06600) | 1325129..1325653 | - | 525 | WP_271780971.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| PJU76_RS06605 (PJU76_06605) | 1325748..1326032 | - | 285 | WP_271780972.1 | hypothetical protein | - |
| PJU76_RS06610 (PJU76_06610) | 1326274..1326507 | + | 234 | WP_271780973.1 | CopG family transcriptional regulator | Antitoxin |
| PJU76_RS06615 (PJU76_06615) | 1326507..1326938 | + | 432 | WP_271780974.1 | VapC toxin family PIN domain ribonuclease | Toxin |
| PJU76_RS06620 (PJU76_06620) | 1327284..1327535 | - | 252 | WP_271780975.1 | hypothetical protein | - |
| PJU76_RS06625 (PJU76_06625) | 1327557..1327763 | + | 207 | WP_271780976.1 | hypothetical protein | - |
| PJU76_RS06630 (PJU76_06630) | 1327821..1328072 | + | 252 | WP_271780977.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| PJU76_RS06635 (PJU76_06635) | 1328087..1328449 | + | 363 | WP_271780978.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PJU76_RS06640 (PJU76_06640) | 1328608..1328994 | + | 387 | WP_271780979.1 | hypothetical protein | - |
| PJU76_RS06645 (PJU76_06645) | 1329136..1329351 | + | 216 | WP_271780980.1 | DUF4926 domain-containing protein | - |
| PJU76_RS06650 (PJU76_06650) | 1329612..1330130 | + | 519 | WP_271780981.1 | DinB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15685.05 Da Isoelectric Point: 6.5750
>T268709 WP_271780974.1 NZ_CP116458:1326507-1326938 [Acidithiobacillus ferriphilus]
MIFLLDVNVLIALIDPMHVQHDMAHEWFAAHGQPAWATCPLTENGVLRIVSHPRYPNSPGTPAAVAPLIQGLRASPGHVF
WPDDISLLDVDHIDASRLLTSGQITNSYLLALACAHEGQLATFDHRLVTNAVRNSLQCINKIK
MIFLLDVNVLIALIDPMHVQHDMAHEWFAAHGQPAWATCPLTENGVLRIVSHPRYPNSPGTPAAVAPLIQGLRASPGHVF
WPDDISLLDVDHIDASRLLTSGQITNSYLLALACAHEGQLATFDHRLVTNAVRNSLQCINKIK
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|