Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-parD/RelE-RHH |
| Location | 407658..408229 | Replicon | chromosome |
| Accession | NZ_CP116458 | ||
| Organism | Acidithiobacillus ferriphilus strain YL25 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PJU76_RS01955 | Protein ID | WP_271780261.1 |
| Coordinates | 407945..408229 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | PJU76_RS01950 | Protein ID | WP_271780260.1 |
| Coordinates | 407658..407945 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJU76_RS01920 (PJU76_01920) | 402714..402863 | - | 150 | WP_009568703.1 | hypothetical protein | - |
| PJU76_RS01925 (PJU76_01925) | 402862..403089 | + | 228 | WP_009568705.1 | DUF6290 family protein | - |
| PJU76_RS01930 (PJU76_01930) | 403430..403975 | - | 546 | WP_271780257.1 | hypothetical protein | - |
| PJU76_RS01935 (PJU76_01935) | 404303..404728 | - | 426 | WP_271780258.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PJU76_RS01940 (PJU76_01940) | 405232..406323 | - | 1092 | WP_271780259.1 | SDR family oxidoreductase | - |
| PJU76_RS01945 (PJU76_01945) | 406454..406933 | - | 480 | WP_215849195.1 | rhodanese-like domain-containing protein | - |
| PJU76_RS01950 (PJU76_01950) | 407658..407945 | + | 288 | WP_271780260.1 | hypothetical protein | Antitoxin |
| PJU76_RS01955 (PJU76_01955) | 407945..408229 | + | 285 | WP_271780261.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PJU76_RS01960 (PJU76_01960) | 408714..409415 | - | 702 | WP_271780262.1 | hypothetical protein | - |
| PJU76_RS01965 (PJU76_01965) | 409645..409767 | - | 123 | WP_271780263.1 | hypothetical protein | - |
| PJU76_RS01970 (PJU76_01970) | 410064..410672 | - | 609 | WP_271780264.1 | restriction endonuclease | - |
| PJU76_RS01975 (PJU76_01975) | 411102..412574 | - | 1473 | WP_271780265.1 | DUF2971 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 397102..442556 | 45454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10781.46 Da Isoelectric Point: 9.5909
>T268707 WP_271780261.1 NZ_CP116458:407945-408229 [Acidithiobacillus ferriphilus]
MKLFWTPEAIQDRDNIYDHIEADNPAAALALDNLFSKKADRLVDHPGQGRPGRIVGTRELVAHRNYILVYDLAKDLVRVL
RVLHAARQWPPVKM
MKLFWTPEAIQDRDNIYDHIEADNPAAALALDNLFSKKADRLVDHPGQGRPGRIVGTRELVAHRNYILVYDLAKDLVRVL
RVLHAARQWPPVKM
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|