Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 301962..302487 | Replicon | chromosome |
Accession | NZ_CP116458 | ||
Organism | Acidithiobacillus ferriphilus strain YL25 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PJU76_RS01430 | Protein ID | WP_271780174.1 |
Coordinates | 302209..302487 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | PJU76_RS01425 | Protein ID | WP_271780173.1 |
Coordinates | 301962..302222 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJU76_RS01405 (PJU76_01405) | 297400..299154 | + | 1755 | WP_271780170.1 | penicillin-binding protein 2 | - |
PJU76_RS01410 (PJU76_01410) | 299151..299462 | + | 312 | WP_215849740.1 | hypothetical protein | - |
PJU76_RS01415 (PJU76_01415) | 299455..299778 | + | 324 | WP_271780171.1 | hypothetical protein | - |
PJU76_RS01420 (PJU76_01420) | 299775..301640 | - | 1866 | WP_271780172.1 | ATP-binding cassette domain-containing protein | - |
PJU76_RS01425 (PJU76_01425) | 301962..302222 | + | 261 | WP_271780173.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PJU76_RS01430 (PJU76_01430) | 302209..302487 | + | 279 | WP_271780174.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PJU76_RS01435 (PJU76_01435) | 303079..303264 | + | 186 | WP_271780175.1 | hypothetical protein | - |
PJU76_RS01440 (PJU76_01440) | 303395..304306 | - | 912 | WP_271780176.1 | hypothetical protein | - |
PJU76_RS01445 (PJU76_01445) | 304484..304738 | - | 255 | WP_271780177.1 | DUF2442 domain-containing protein | - |
PJU76_RS01450 (PJU76_01450) | 304771..305031 | - | 261 | WP_271780178.1 | DUF4160 domain-containing protein | - |
PJU76_RS01455 (PJU76_01455) | 305130..305480 | - | 351 | WP_064220135.1 | DUF4870 domain-containing protein | - |
PJU76_RS01460 (PJU76_01460) | 305673..305813 | - | 141 | Protein_287 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10621.23 Da Isoelectric Point: 8.9489
>T268706 WP_271780174.1 NZ_CP116458:302209-302487 [Acidithiobacillus ferriphilus]
MRTTKQTSQFKRDLKRESKGPYRKSLQEGFVALIEALAADLVLDQKYLDHPLSGDWIDHRDCHFKPDLVLIYRKTEGVLQ
LVRLGSHSELGL
MRTTKQTSQFKRDLKRESKGPYRKSLQEGFVALIEALAADLVLDQKYLDHPLSGDWIDHRDCHFKPDLVLIYRKTEGVLQ
LVRLGSHSELGL
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|