Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 218189..218817 | Replicon | chromosome |
| Accession | NZ_CP116458 | ||
| Organism | Acidithiobacillus ferriphilus strain YL25 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PJU76_RS01035 | Protein ID | WP_271780106.1 |
| Coordinates | 218416..218817 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PJU76_RS01030 | Protein ID | WP_271780105.1 |
| Coordinates | 218189..218419 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJU76_RS01005 (PJU76_01005) | 214144..214506 | + | 363 | WP_271780101.1 | response regulator | - |
| PJU76_RS01010 (PJU76_01010) | 214524..215600 | + | 1077 | WP_271780102.1 | response regulator | - |
| PJU76_RS01015 (PJU76_01015) | 215613..215813 | - | 201 | WP_215849469.1 | hypothetical protein | - |
| PJU76_RS01020 (PJU76_01020) | 215824..217194 | - | 1371 | WP_271780103.1 | divalent metal cation transporter | - |
| PJU76_RS01025 (PJU76_01025) | 217386..217964 | + | 579 | WP_271780104.1 | DUF4337 domain-containing protein | - |
| PJU76_RS01030 (PJU76_01030) | 218189..218419 | + | 231 | WP_271780105.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PJU76_RS01035 (PJU76_01035) | 218416..218817 | + | 402 | WP_271780106.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PJU76_RS01040 (PJU76_01040) | 218993..219523 | + | 531 | WP_271780107.1 | DedA family protein | - |
| PJU76_RS01050 (PJU76_01050) | 220263..221042 | - | 780 | WP_271780108.1 | ABC transporter permease | - |
| PJU76_RS01055 (PJU76_01055) | 221039..221980 | - | 942 | WP_271780109.1 | ATP-binding cassette domain-containing protein | - |
| PJU76_RS01060 (PJU76_01060) | 221949..222674 | - | 726 | WP_271780110.1 | CocE/NonD family hydrolase | - |
| PJU76_RS01065 (PJU76_01065) | 222674..222964 | - | 291 | WP_271780111.1 | (2Fe-2S) ferredoxin domain-containing protein | - |
| PJU76_RS01070 (PJU76_01070) | 223064..223690 | + | 627 | WP_271780112.1 | 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15008.43 Da Isoelectric Point: 9.0203
>T268705 WP_271780106.1 NZ_CP116458:218416-218817 [Acidithiobacillus ferriphilus]
VINYLLDTNICIFTIKCKPPEIREQFRRYHGQMAISAVTLMELIYGAEKSQAPERNLAEIEGFAARLELLEYGSEAAKHT
GQIRAELAKVGKPIGPYDQMIAGHARSRGLIVVTNNLRKFERVPGLRVVDWVQ
VINYLLDTNICIFTIKCKPPEIREQFRRYHGQMAISAVTLMELIYGAEKSQAPERNLAEIEGFAARLELLEYGSEAAKHT
GQIRAELAKVGKPIGPYDQMIAGHARSRGLIVVTNNLRKFERVPGLRVVDWVQ
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|