Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1617646..1618258 | Replicon | chromosome |
Accession | NZ_CP116457 | ||
Organism | Streptococcus pyogenes strain 1095 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q5X9X8 |
Locus tag | PJV85_RS07965 | Protein ID | WP_011018227.1 |
Coordinates | 1617923..1618258 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | PJV85_RS07960 | Protein ID | WP_002988079.1 |
Coordinates | 1617646..1617933 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJV85_RS07935 (PJV85_07935) | 1612823..1613806 | - | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
PJV85_RS07940 (PJV85_07940) | 1613810..1614739 | - | 930 | WP_010922663.1 | tagatose-6-phosphate kinase | - |
PJV85_RS07945 (PJV85_07945) | 1614787..1615302 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
PJV85_RS07950 (PJV85_07950) | 1615337..1615765 | - | 429 | WP_010922664.1 | galactose-6-phosphate isomerase subunit LacA | - |
PJV85_RS07955 (PJV85_07955) | 1616212..1616985 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PJV85_RS07960 (PJV85_07960) | 1617646..1617933 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
PJV85_RS07965 (PJV85_07965) | 1617923..1618258 | + | 336 | WP_011018227.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PJV85_RS07970 (PJV85_07970) | 1618356..1619363 | + | 1008 | Protein_1510 | site-specific integrase | - |
PJV85_RS07975 (PJV85_07975) | 1619483..1619875 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
PJV85_RS07980 (PJV85_07980) | 1619896..1620342 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
PJV85_RS07985 (PJV85_07985) | 1620560..1620766 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
PJV85_RS07990 (PJV85_07990) | 1620763..1621269 | - | 507 | WP_002988070.1 | hypothetical protein | - |
PJV85_RS07995 (PJV85_07995) | 1621405..1622265 | - | 861 | WP_002982687.1 | DegV family protein | - |
PJV85_RS08000 (PJV85_08000) | 1622362..1622880 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13171.97 Da Isoelectric Point: 5.2144
>T268703 WP_011018227.1 NZ_CP116457:1617923-1618258 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z2QKE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |