Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 100625..101237 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP116426 | ||
| Organism | Sulfitobacter faviae strain SCSIO W_1865 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PL336_RS18755 | Protein ID | WP_028288627.1 |
| Coordinates | 100842..101237 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A921TG38 |
| Locus tag | PL336_RS18750 | Protein ID | WP_009503866.1 |
| Coordinates | 100625..100852 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL336_RS18735 (PL336_18735) | 96882..98093 | - | 1212 | WP_050525470.1 | plasmid replication protein RepC | - |
| PL336_RS18740 (PL336_18740) | 98307..99239 | - | 933 | WP_028288626.1 | plasmid partitioning protein RepB | - |
| PL336_RS18745 (PL336_18745) | 99223..100416 | - | 1194 | WP_009503867.1 | plasmid partitioning protein RepA | - |
| PL336_RS18750 (PL336_18750) | 100625..100852 | + | 228 | WP_009503866.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PL336_RS18755 (PL336_18755) | 100842..101237 | + | 396 | WP_028288627.1 | PIN domain-containing protein | Toxin |
| PL336_RS18760 (PL336_18760) | 101316..102200 | - | 885 | WP_028288628.1 | recombinase family protein | - |
| PL336_RS18765 (PL336_18765) | 102430..103497 | + | 1068 | WP_088635931.1 | hypothetical protein | - |
| PL336_RS18770 (PL336_18770) | 103713..104303 | + | 591 | WP_088635923.1 | L,D-transpeptidase | - |
| PL336_RS18775 (PL336_18775) | 104387..104965 | + | 579 | WP_009815505.1 | L,D-transpeptidase | - |
| PL336_RS18780 (PL336_18780) | 105029..105786 | + | 758 | WP_088635922.1 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..182751 | 182751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14212.23 Da Isoelectric Point: 4.1653
>T268701 WP_028288627.1 NZ_CP116426:100842-101237 [Sulfitobacter faviae]
MSVEFADTNVVLYLLDDGPKADRAEVILGQGPRISVQVLNESLVNCRRKAGLGWEEAAAFLEGVRALCPVEDLTVQTHDV
GRALAERYGFSIYDAMIVASALVAGCTTLWSEDMQDGLLVEGQLRIVNPFA
MSVEFADTNVVLYLLDDGPKADRAEVILGQGPRISVQVLNESLVNCRRKAGLGWEEAAAFLEGVRALCPVEDLTVQTHDV
GRALAERYGFSIYDAMIVASALVAGCTTLWSEDMQDGLLVEGQLRIVNPFA
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|