Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/NGN_SP-Phd |
Location | 3523510..3524195 | Replicon | chromosome |
Accession | NZ_CP116413 | ||
Organism | Crossiella sp. CA-258035 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N8J89_RS16270 | Protein ID | WP_283665186.1 |
Coordinates | 3523779..3524195 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N8J89_RS16265 | Protein ID | WP_283665185.1 |
Coordinates | 3523510..3523782 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8J89_RS16245 (N8J89_16245) | 3519516..3519911 | + | 396 | WP_283665181.1 | winged helix-turn-helix transcriptional regulator | - |
N8J89_RS16250 (N8J89_16250) | 3520099..3521448 | - | 1350 | WP_283665182.1 | hypothetical protein | - |
N8J89_RS16255 (N8J89_16255) | 3521476..3521937 | - | 462 | WP_283665183.1 | hypothetical protein | - |
N8J89_RS16260 (N8J89_16260) | 3522558..3523436 | + | 879 | WP_283665184.1 | helix-turn-helix transcriptional regulator | - |
N8J89_RS16265 (N8J89_16265) | 3523510..3523782 | + | 273 | WP_283665185.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N8J89_RS16270 (N8J89_16270) | 3523779..3524195 | + | 417 | WP_283665186.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N8J89_RS16275 (N8J89_16275) | 3524246..3524728 | + | 483 | WP_283665187.1 | hypothetical protein | - |
N8J89_RS16280 (N8J89_16280) | 3524799..3526145 | - | 1347 | WP_283665188.1 | hypothetical protein | - |
N8J89_RS16285 (N8J89_16285) | 3526393..3526929 | + | 537 | WP_283665189.1 | hypothetical protein | - |
N8J89_RS16290 (N8J89_16290) | 3527159..3527638 | + | 480 | WP_283665190.1 | helix-turn-helix domain-containing protein | - |
N8J89_RS16295 (N8J89_16295) | 3527993..3528427 | + | 435 | WP_283665191.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3496993..3535217 | 38224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15088.33 Da Isoelectric Point: 4.9008
>T268697 WP_283665186.1 NZ_CP116413:3523779-3524195 [Crossiella sp. CA-258035]
MSFLLDTNIVSEIRKKNPNRGVAEWFDSVSASELFVSVLVVGEIRQGIERLARRDSAQAAVFEQWLGRLLEVYGDRIVPV
TAEVAEAWGRLNVPDPVPVVDGLMAATALVRGWTLVTRNRADVAATGVRLLDPFTGAV
MSFLLDTNIVSEIRKKNPNRGVAEWFDSVSASELFVSVLVVGEIRQGIERLARRDSAQAAVFEQWLGRLLEVYGDRIVPV
TAEVAEAWGRLNVPDPVPVVDGLMAATALVRGWTLVTRNRADVAATGVRLLDPFTGAV
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|