Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3545001..3545619 | Replicon | chromosome |
| Accession | NZ_CP116411 | ||
| Organism | Escherichia coli strain HH45 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PL330_RS16985 | Protein ID | WP_001291435.1 |
| Coordinates | 3545401..3545619 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PL330_RS16980 | Protein ID | WP_000344800.1 |
| Coordinates | 3545001..3545375 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL330_RS16970 (3540090) | 3540090..3541283 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PL330_RS16975 (3541306) | 3541306..3544455 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| PL330_RS16980 (3545001) | 3545001..3545375 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PL330_RS16985 (3545401) | 3545401..3545619 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PL330_RS16990 (3545791) | 3545791..3546342 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| PL330_RS16995 (3546458) | 3546458..3546928 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PL330_RS17000 (3547092) | 3547092..3548642 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PL330_RS17005 (3548684) | 3548684..3549037 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| PL330_RS17015 (3549416) | 3549416..3549727 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| PL330_RS17020 (3549758) | 3549758..3550330 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268692 WP_001291435.1 NZ_CP116411:3545401-3545619 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268692 WP_000344800.1 NZ_CP116411:3545001-3545375 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |