Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1202033..1202691 | Replicon | chromosome |
Accession | NZ_CP116411 | ||
Organism | Escherichia coli strain HH45 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | PL330_RS05785 | Protein ID | WP_271710746.1 |
Coordinates | 1202033..1202353 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PL330_RS05790 | Protein ID | WP_105609402.1 |
Coordinates | 1202374..1202691 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL330_RS05770 (1197455) | 1197455..1198903 | - | 1449 | WP_000772847.1 | NADP-dependent succinate-semialdehyde dehydrogenase | - |
PL330_RS05775 (1198926) | 1198926..1200194 | - | 1269 | WP_000271942.1 | L-2-hydroxyglutarate oxidase | - |
PL330_RS05780 (1200214) | 1200214..1201191 | - | 978 | WP_000993087.1 | glutarate dioxygenase GlaH | - |
PL330_RS05785 (1202033) | 1202033..1202353 | - | 321 | WP_271710746.1 | TA system toxin CbtA family protein | Toxin |
PL330_RS05790 (1202374) | 1202374..1202691 | - | 318 | WP_105609402.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PL330_RS05795 (1202767) | 1202767..1202931 | - | 165 | WP_072025243.1 | DUF987 family protein | - |
PL330_RS05800 (1202940) | 1202940..1203416 | - | 477 | WP_047620722.1 | RadC family protein | - |
PL330_RS05805 (1203432) | 1203432..1203946 | - | 515 | Protein_1135 | antirestriction protein | - |
PL330_RS05810 (1203977) | 1203977..1204159 | - | 183 | Protein_1136 | DUF905 family protein | - |
PL330_RS05815 (1204315) | 1204315..1205382 | - | 1068 | WP_001683202.1 | hypothetical protein | - |
PL330_RS05820 (1205673) | 1205673..1206384 | - | 712 | Protein_1138 | DeoR family transcriptional regulator | - |
PL330_RS05825 (1206603) | 1206603..1207410 | - | 808 | Protein_1139 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12131.32 Da Isoelectric Point: 10.2638
>T268686 WP_271710746.1 NZ_CP116411:c1202353-1202033 [Escherichia coli]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLANAVNFLVKKYELVRIDRKGF
SWQKQSPFITAVDILKARRAMREMRT
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLANAVNFLVKKYELVRIDRKGF
SWQKQSPFITAVDILKARRAMREMRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|