Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 765317..766148 | Replicon | chromosome |
| Accession | NZ_CP116411 | ||
| Organism | Escherichia coli strain HH45 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PL330_RS03690 | Protein ID | WP_271710720.1 |
| Coordinates | 765317..765691 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | PL330_RS03695 | Protein ID | WP_001285585.1 |
| Coordinates | 765780..766148 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL330_RS03660 (760430) | 760430..761578 | - | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| PL330_RS03665 (761650) | 761650..762633 | - | 984 | WP_001331698.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| PL330_RS03670 (763443) | 763443..763613 | - | 171 | Protein_720 | IS110 family transposase | - |
| PL330_RS03675 (763957) | 763957..764526 | - | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| PL330_RS03680 (764623) | 764623..764820 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| PL330_RS03685 (764832) | 764832..765320 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| PL330_RS03690 (765317) | 765317..765691 | - | 375 | WP_271710720.1 | TA system toxin CbtA family protein | Toxin |
| PL330_RS03695 (765780) | 765780..766148 | - | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PL330_RS03700 (766228) | 766228..766449 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| PL330_RS03705 (766536) | 766536..767012 | - | 477 | WP_001186773.1 | RadC family protein | - |
| PL330_RS03710 (767028) | 767028..767513 | - | 486 | WP_271710721.1 | antirestriction protein | - |
| PL330_RS03715 (767604) | 767604..768422 | - | 819 | WP_271710722.1 | DUF932 domain-containing protein | - |
| PL330_RS03720 (768512) | 768512..768745 | - | 234 | WP_001278283.1 | DUF905 family protein | - |
| PL330_RS03725 (768751) | 768751..769428 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| PL330_RS03730 (769576) | 769576..770256 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 763443..763547 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14116.11 Da Isoelectric Point: 7.8276
>T268683 WP_271710720.1 NZ_CP116411:c765691-765317 [Escherichia coli]
MKTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPEKR
MKTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT268683 WP_001285585.1 NZ_CP116411:c766148-765780 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|