Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 87301..87826 | Replicon | plasmid pHH97 |
Accession | NZ_CP116410 | ||
Organism | Escherichia coli strain HH97 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | PL329_RS24465 | Protein ID | WP_271711335.1 |
Coordinates | 87301..87606 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PL329_RS24470 | Protein ID | WP_000813634.1 |
Coordinates | 87608..87826 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL329_RS24435 (82567) | 82567..83837 | + | 1271 | Protein_103 | translesion error-prone DNA polymerase V subunit UmuC | - |
PL329_RS24440 (83842) | 83842..84234 | - | 393 | WP_000340835.1 | plasmid partitioning/stability family protein | - |
PL329_RS24445 (84239) | 84239..85210 | - | 972 | WP_001103694.1 | plasmid segregation protein ParM | - |
PL329_RS24450 (85439) | 85439..86083 | + | 645 | WP_271711334.1 | AAA family ATPase | - |
PL329_RS24455 (86077) | 86077..86352 | + | 276 | WP_000239529.1 | hypothetical protein | - |
PL329_RS24460 (86491) | 86491..87300 | - | 810 | WP_000016979.1 | site-specific integrase | - |
PL329_RS24465 (87301) | 87301..87606 | - | 306 | WP_271711335.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PL329_RS24470 (87608) | 87608..87826 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PL329_RS24475 (90147) | 90147..90788 | + | 642 | WP_000990667.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..114684 | 114684 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11702.53 Da Isoelectric Point: 6.4674
>T268679 WP_271711335.1 NZ_CP116410:c87606-87301 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|