Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4722969..4723803 | Replicon | chromosome |
| Accession | NZ_CP116409 | ||
| Organism | Escherichia coli strain HH97 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2T3TJB4 |
| Locus tag | PL329_RS23120 | Protein ID | WP_000854811.1 |
| Coordinates | 4723426..4723803 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | PL329_RS23115 | Protein ID | WP_001285610.1 |
| Coordinates | 4722969..4723337 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL329_RS23080 (4718690) | 4718690..4719370 | + | 681 | WP_271711072.1 | WYL domain-containing protein | - |
| PL329_RS23085 (4719521) | 4719521..4720198 | + | 678 | WP_001097565.1 | hypothetical protein | - |
| PL329_RS23090 (4720204) | 4720204..4720437 | + | 234 | WP_000883181.1 | DUF905 family protein | - |
| PL329_RS23095 (4720527) | 4720527..4721345 | + | 819 | WP_271711073.1 | DUF932 domain-containing protein | - |
| PL329_RS23100 (4721611) | 4721611..4722090 | + | 480 | WP_000706978.1 | antirestriction protein | - |
| PL329_RS23105 (4722105) | 4722105..4722581 | + | 477 | WP_001186194.1 | RadC family protein | - |
| PL329_RS23110 (4722668) | 4722668..4722889 | + | 222 | WP_000692347.1 | DUF987 domain-containing protein | - |
| PL329_RS23115 (4722969) | 4722969..4723337 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PL329_RS23120 (4723426) | 4723426..4723803 | + | 378 | WP_000854811.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PL329_RS23125 (4723800) | 4723800..4723949 | + | 150 | Protein_4515 | DUF5983 family protein | - |
| PL329_RS23130 (4724025) | 4724025..4724222 | + | 198 | WP_086795284.1 | DUF957 domain-containing protein | - |
| PL329_RS23135 (4724307) | 4724307..4724867 | + | 561 | Protein_4517 | DUF4942 domain-containing protein | - |
| PL329_RS23140 (4725703) | 4725703..4727241 | + | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4710658..4735054 | 24396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14041.14 Da Isoelectric Point: 7.8839
>T268677 WP_000854811.1 NZ_CP116409:4723426-4723803 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT268677 WP_001285610.1 NZ_CP116409:4722969-4723337 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|