Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2172843..2173674 Replicon chromosome
Accession NZ_CP116409
Organism Escherichia coli strain HH97

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PL329_RS10575 Protein ID WP_000854814.1
Coordinates 2172843..2173217 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag PL329_RS10580 Protein ID WP_001285585.1
Coordinates 2173306..2173674 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PL329_RS10535 (2168239) 2168239..2169405 + 1167 WP_096991308.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
PL329_RS10540 (2169524) 2169524..2169997 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
PL329_RS10545 (2170195) 2170195..2171253 + 1059 WP_001200891.1 FUSC family protein -
PL329_RS10550 (2171425) 2171425..2171754 + 330 WP_000450409.1 DUF496 family protein -
PL329_RS10555 (2171855) 2171855..2171989 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
PL329_RS10560 (2172091) 2172091..2172237 + 147 Protein_2055 transposase domain-containing protein -
PL329_RS10565 (2172526) 2172526..2172606 - 81 Protein_2056 hypothetical protein -
PL329_RS10570 (2172652) 2172652..2172846 - 195 WP_000988600.1 DUF5983 family protein -
PL329_RS10575 (2172843) 2172843..2173217 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PL329_RS10580 (2173306) 2173306..2173674 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PL329_RS10585 (2173748) 2173748..2173969 - 222 WP_000692323.1 DUF987 domain-containing protein -
PL329_RS10590 (2174032) 2174032..2174508 - 477 WP_143369540.1 RadC family protein -
PL329_RS10595 (2174524) 2174524..2175003 - 480 WP_271711278.1 antirestriction protein -
PL329_RS10600 (2175085) 2175085..2175906 - 822 WP_001234530.1 DUF932 domain-containing protein -
PL329_RS10605 (2176127) 2176127..2176537 - 411 WP_000846713.1 hypothetical protein -
PL329_RS10610 (2176553) 2176553..2177236 - 684 WP_000775500.1 hypothetical protein -
PL329_RS10615 (2177372) 2177372..2178442 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T268667 WP_000854814.1 NZ_CP116409:c2173217-2172843 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT268667 WP_001285585.1 NZ_CP116409:c2173674-2173306 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References