Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1344324..1344907 | Replicon | chromosome |
| Accession | NZ_CP116409 | ||
| Organism | Escherichia coli strain HH97 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | PL329_RS06435 | Protein ID | WP_000254738.1 |
| Coordinates | 1344572..1344907 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | PL329_RS06430 | Protein ID | WP_000581937.1 |
| Coordinates | 1344324..1344572 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL329_RS06420 (1340663) | 1340663..1341964 | + | 1302 | WP_271711187.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| PL329_RS06425 (1342012) | 1342012..1344246 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| PL329_RS06430 (1344324) | 1344324..1344572 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PL329_RS06435 (1344572) | 1344572..1344907 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| PL329_RS06440 (1344978) | 1344978..1345769 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| PL329_RS06445 (1345997) | 1345997..1347634 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| PL329_RS06450 (1347722) | 1347722..1349020 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T268666 WP_000254738.1 NZ_CP116409:1344572-1344907 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|