Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1190285..1190939 | Replicon | chromosome |
Accession | NZ_CP116409 | ||
Organism | Escherichia coli strain HH97 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | PL329_RS05800 | Protein ID | WP_000244781.1 |
Coordinates | 1190532..1190939 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PL329_RS05795 | Protein ID | WP_000354046.1 |
Coordinates | 1190285..1190551 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL329_RS05775 (1186254) | 1186254..1187687 | - | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
PL329_RS05780 (1187732) | 1187732..1188043 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
PL329_RS05785 (1188207) | 1188207..1188866 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
PL329_RS05790 (1189062) | 1189062..1190042 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
PL329_RS05795 (1190285) | 1190285..1190551 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PL329_RS05800 (1190532) | 1190532..1190939 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
PL329_RS05805 (1190979) | 1190979..1191500 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
PL329_RS05810 (1191612) | 1191612..1192508 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PL329_RS05815 (1192533) | 1192533..1193243 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PL329_RS05820 (1193249) | 1193249..1194982 | + | 1734 | WP_271711177.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T268665 WP_000244781.1 NZ_CP116409:1190532-1190939 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|