Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1072287..1073088 Replicon chromosome
Accession NZ_CP116409
Organism Escherichia coli strain HH97

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag PL329_RS05175 Protein ID WP_001094436.1
Coordinates 1072287..1072664 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag PL329_RS05180 Protein ID WP_015953067.1
Coordinates 1072711..1073088 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PL329_RS05150 (1068490) 1068490..1068660 - 171 Protein_997 IS110 family transposase -
PL329_RS05155 (1069057) 1069057..1070592 - 1536 WP_000492897.1 EAL domain-containing protein -
PL329_RS05160 (1070663) 1070663..1071508 - 846 WP_271711157.1 DUF4942 domain-containing protein -
PL329_RS05165 (1071593) 1071593..1071790 - 198 WP_000839254.1 DUF957 domain-containing protein -
PL329_RS05170 (1071802) 1071802..1072290 - 489 WP_000761714.1 DUF5983 family protein -
PL329_RS05175 (1072287) 1072287..1072664 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
PL329_RS05180 (1072711) 1072711..1073088 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PL329_RS05185 (1073167) 1073167..1073388 - 222 WP_000692300.1 DUF987 domain-containing protein -
PL329_RS05190 (1073457) 1073457..1073933 - 477 WP_271711158.1 RadC family protein -
PL329_RS05195 (1073948) 1073948..1074433 - 486 WP_000860055.1 antirestriction protein -
PL329_RS05200 (1074524) 1074524..1075342 - 819 WP_271711159.1 DUF932 domain-containing protein -
PL329_RS05205 (1075432) 1075432..1075665 - 234 WP_001278287.1 DUF905 family protein -
PL329_RS05210 (1075671) 1075671..1076348 - 678 WP_001097312.1 hypothetical protein -
PL329_RS05215 (1076496) 1076496..1077176 - 681 WP_001282915.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 1068875..1122135 53260
- flank IS/Tn - - 1068490..1068594 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T268664 WP_001094436.1 NZ_CP116409:c1072664-1072287 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT268664 WP_015953067.1 NZ_CP116409:c1073088-1072711 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References