Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3701566..3702245 | Replicon | chromosome |
| Accession | NZ_CP116405 | ||
| Organism | Escherichia coli strain HH107 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | PL328_RS18060 | Protein ID | WP_000854680.1 |
| Coordinates | 3701904..3702245 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | PL328_RS18055 | Protein ID | WP_000070396.1 |
| Coordinates | 3701566..3701883 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL328_RS18010 (3697003) | 3697003..3697824 | + | 822 | WP_085381467.1 | DUF932 domain-containing protein | - |
| PL328_RS18015 (3698041) | 3698041..3698742 | + | 702 | WP_023326104.1 | WYL domain-containing protein | - |
| PL328_RS18020 (3698783) | 3698783..3699019 | + | 237 | WP_057107659.1 | protein YpjK | - |
| PL328_RS18025 (3699019) | 3699019..3699462 | + | 444 | WP_016239438.1 | lipoprotein YafY | - |
| PL328_RS18030 (3699486) | 3699486..3699953 | + | 468 | WP_057107658.1 | protein YkfB | - |
| PL328_RS18035 (3700030) | 3700030..3700269 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| PL328_RS18040 (3700367) | 3700367..3700825 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| PL328_RS18045 (3700841) | 3700841..3701317 | + | 477 | WP_000811693.1 | RadC family protein | - |
| PL328_RS18050 (3701326) | 3701326..3701547 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| PL328_RS18055 (3701566) | 3701566..3701883 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| PL328_RS18060 (3701904) | 3701904..3702245 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| PL328_RS18065 (3702785) | 3702785..3703591 | + | 807 | WP_180385203.1 | phage integrase SAM-like domain-containing protein | - |
| PL328_RS18075 (3704281) | 3704281..3704487 | + | 207 | Protein_3540 | integrase core domain-containing protein | - |
| PL328_RS18080 (3704529) | 3704529..3705272 | - | 744 | WP_000246052.1 | AraC family transcriptional regulator | - |
| PL328_RS18085 (3705797) | 3705797..3706777 | - | 981 | WP_000019402.1 | IS5-like element IS5 family transposase | - |
| PL328_RS18090 (3706848) | 3706848..3707147 | + | 300 | Protein_3543 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T268656 WP_000854680.1 NZ_CP116405:3701904-3702245 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|