Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3701566..3702245 Replicon chromosome
Accession NZ_CP116405
Organism Escherichia coli strain HH107

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag PL328_RS18060 Protein ID WP_000854680.1
Coordinates 3701904..3702245 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag PL328_RS18055 Protein ID WP_000070396.1
Coordinates 3701566..3701883 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PL328_RS18010 (3697003) 3697003..3697824 + 822 WP_085381467.1 DUF932 domain-containing protein -
PL328_RS18015 (3698041) 3698041..3698742 + 702 WP_023326104.1 WYL domain-containing protein -
PL328_RS18020 (3698783) 3698783..3699019 + 237 WP_057107659.1 protein YpjK -
PL328_RS18025 (3699019) 3699019..3699462 + 444 WP_016239438.1 lipoprotein YafY -
PL328_RS18030 (3699486) 3699486..3699953 + 468 WP_057107658.1 protein YkfB -
PL328_RS18035 (3700030) 3700030..3700269 + 240 WP_000194654.1 DUF905 family protein -
PL328_RS18040 (3700367) 3700367..3700825 + 459 WP_000211838.1 antirestriction protein -
PL328_RS18045 (3700841) 3700841..3701317 + 477 WP_000811693.1 RadC family protein -
PL328_RS18050 (3701326) 3701326..3701547 + 222 WP_000691994.1 DUF987 domain-containing protein -
PL328_RS18055 (3701566) 3701566..3701883 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
PL328_RS18060 (3701904) 3701904..3702245 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
PL328_RS18065 (3702785) 3702785..3703591 + 807 WP_180385203.1 phage integrase SAM-like domain-containing protein -
PL328_RS18075 (3704281) 3704281..3704487 + 207 Protein_3540 integrase core domain-containing protein -
PL328_RS18080 (3704529) 3704529..3705272 - 744 WP_000246052.1 AraC family transcriptional regulator -
PL328_RS18085 (3705797) 3705797..3706777 - 981 WP_000019402.1 IS5-like element IS5 family transposase -
PL328_RS18090 (3706848) 3706848..3707147 + 300 Protein_3543 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T268656 WP_000854680.1 NZ_CP116405:3701904-3702245 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT268656 WP_000070396.1 NZ_CP116405:3701566-3701883 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References