268646

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 953177..953838 Replicon chromosome
Accession NZ_CP116405
Organism Escherichia coli strain HH107

Toxin (Protein)


Gene name ypjF Uniprot ID S3IMJ6
Locus tag PL328_RS04630 Protein ID WP_000698542.1
Coordinates 953515..953838 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID S3J179
Locus tag PL328_RS04625 Protein ID WP_000065326.1
Coordinates 953177..953494 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PL328_RS04580 (948317) 948317..949141 + 825 WP_000197385.1 DUF932 domain-containing protein -
PL328_RS04585 (949350) 949350..950060 + 711 WP_024198336.1 hypothetical protein -
PL328_RS04590 (950086) 950086..950622 + 537 WP_000219797.1 DUF4339 domain-containing protein -
PL328_RS04595 (950664) 950664..951101 + 438 WP_024198335.1 hypothetical protein -
PL328_RS04600 (951168) 951168..951578 + 411 WP_000912997.1 hypothetical protein -
PL328_RS04605 (951656) 951656..951892 + 237 WP_000004273.1 DUF905 domain-containing protein -
PL328_RS04610 (951978) 951978..952436 + 459 WP_016538084.1 antirestriction protein -
PL328_RS04615 (952452) 952452..952928 + 477 WP_000811694.1 RadC family protein -
PL328_RS04620 (952937) 952937..953158 + 222 WP_000691995.1 DUF987 domain-containing protein -
PL328_RS04625 (953177) 953177..953494 + 318 WP_000065326.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PL328_RS04630 (953515) 953515..953838 + 324 WP_000698542.1 TA system toxin CbtA family protein Toxin
PL328_RS04635 (954280) 954280..955890 + 1611 WP_123056634.1 glycoside hydrolase family 15 protein -
PL328_RS04640 (955982) 955982..956969 + 988 Protein_911 YscQ/HrcQ family type III secretion apparatus protein -
PL328_RS04645 (956959) 956959..957624 + 666 WP_102595935.1 EscR/YscR/HrcR family type III secretion system export apparatus protein -
PL328_RS04650 (957634) 957634..957894 + 261 WP_000341004.1 EscS/YscS/HrcS family type III secretion system export apparatus protein -
PL328_RS04655 (957896) 957896..958663 + 768 WP_085381318.1 type III secretion system export apparatus subunit SctT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - spaP / spaQ / spaS 928697..972682 43985


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-107)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.38 Da        Isoelectric Point: 8.9789

>T268646 WP_000698542.1 NZ_CP116405:953515-953838 [Escherichia coli]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN

Download         Length: 324 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11830.50 Da        Isoelectric Point: 6.9367

>AT268646 WP_000065326.1 NZ_CP116405:953177-953494 [Escherichia coli]
MSNIIWGLQRDITPRLGTRLVQEGNQLHYLADRACITGKFSDAECLKLDVAFPHFISRMESMLSTGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYVAVYSTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3IMJ6

Antitoxin

Source ID Structure
AlphaFold DB S3J179

References