Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 886627..887281 | Replicon | chromosome |
| Accession | NZ_CP116405 | ||
| Organism | Escherichia coli strain HH107 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | PL328_RS04300 | Protein ID | WP_000244781.1 |
| Coordinates | 886874..887281 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PL328_RS04295 | Protein ID | WP_000354046.1 |
| Coordinates | 886627..886893 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL328_RS04270 (881915) | 881915..882658 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| PL328_RS04275 (882715) | 882715..884148 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| PL328_RS04280 (884193) | 884193..884504 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PL328_RS04285 (884668) | 884668..885327 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PL328_RS04290 (885404) | 885404..886384 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
| PL328_RS04295 (886627) | 886627..886893 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PL328_RS04300 (886874) | 886874..887281 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| PL328_RS04305 (887321) | 887321..887842 | - | 522 | WP_044863754.1 | flavodoxin FldB | - |
| PL328_RS04310 (887954) | 887954..888850 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PL328_RS04315 (888875) | 888875..889585 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PL328_RS04320 (889591) | 889591..891324 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T268645 WP_000244781.1 NZ_CP116405:886874-887281 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|