Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT_toxin-BrnA |
Location | 1580910..1581447 | Replicon | chromosome |
Accession | NZ_CP116404 | ||
Organism | Burkholderia pseudomallei strain MSHR5087 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | PL318_RS24285 | Protein ID | WP_009923450.1 |
Coordinates | 1580910..1581179 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | Q63NA3 |
Locus tag | PL318_RS24290 | Protein ID | WP_004525420.1 |
Coordinates | 1581163..1581447 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL318_RS24240 (PL318_24240) | 1576689..1577117 | - | 429 | Protein_1347 | integrase core domain-containing protein | - |
PL318_RS24245 (PL318_24245) | 1577316..1577849 | - | 534 | Protein_1348 | SPFH domain-containing protein | - |
PL318_RS24250 (PL318_24250) | 1577885..1578034 | - | 150 | WP_004537646.1 | bacteriophage protein Gp44 | - |
PL318_RS24255 (PL318_24255) | 1578283..1578936 | + | 654 | WP_004545536.1 | hypothetical protein | - |
PL318_RS24260 (PL318_24260) | 1579122..1579340 | - | 219 | WP_004552392.1 | hypothetical protein | - |
PL318_RS24265 (PL318_24265) | 1579388..1579546 | - | 159 | WP_004549802.1 | hypothetical protein | - |
PL318_RS24270 (PL318_24270) | 1579543..1579785 | - | 243 | WP_004545584.1 | hypothetical protein | - |
PL318_RS24275 (PL318_24275) | 1579923..1580054 | - | 132 | WP_009923452.1 | bacteriophage protein Gp48 | - |
PL318_RS24280 (PL318_24280) | 1580064..1580339 | - | 276 | WP_004552388.1 | bacteriophage protein Gp49 | - |
PL318_RS24285 (PL318_24285) | 1580910..1581179 | + | 270 | WP_009923450.1 | BrnT family toxin | Toxin |
PL318_RS24290 (PL318_24290) | 1581163..1581447 | + | 285 | WP_004525420.1 | BrnA antitoxin family protein | Antitoxin |
PL318_RS24300 (PL318_24300) | 1582094..1582477 | + | 384 | Protein_1358 | integrase core domain-containing protein | - |
PL318_RS24305 (PL318_24305) | 1582476..1582868 | + | 393 | Protein_1359 | IS110 family transposase | - |
PL318_RS24310 (PL318_24310) | 1583095..1583211 | - | 117 | Protein_1360 | transposase | - |
PL318_RS24315 (PL318_24315) | 1583458..1584918 | + | 1461 | WP_038737257.1 | metallophosphoesterase | - |
PL318_RS24320 (PL318_24320) | 1585077..1586339 | + | 1263 | WP_009975402.1 | cytochrome c peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1560792..1584918 | 24126 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10156.52 Da Isoelectric Point: 7.1633
>T268642 WP_009923450.1 NZ_CP116404:1580910-1581179 [Burkholderia pseudomallei]
MDITFDPTKNKTNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDSMHIISMRKANKR
EVKSYVEQA
MDITFDPTKNKTNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDSMHIISMRKANKR
EVKSYVEQA
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|