Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3434444..3435049 | Replicon | chromosome |
| Accession | NZ_CP116398 | ||
| Organism | Methylomonas sp. EFPC3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PL263_RS15375 | Protein ID | WP_256608988.1 |
| Coordinates | 3434753..3435049 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PL263_RS15370 | Protein ID | WP_256608987.1 |
| Coordinates | 3434444..3434749 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL263_RS15350 (PL263_15345) | 3430391..3431359 | - | 969 | WP_278210150.1 | DUF882 domain-containing protein | - |
| PL263_RS15355 (PL263_15350) | 3431553..3432440 | - | 888 | WP_278210151.1 | inositol monophosphatase family protein | - |
| PL263_RS15360 (PL263_15355) | 3432443..3433417 | - | 975 | WP_278210152.1 | phosphotransferase | - |
| PL263_RS15365 (PL263_15360) | 3433465..3434265 | - | 801 | WP_278210153.1 | indole-3-glycerol phosphate synthase TrpC | - |
| PL263_RS15370 (PL263_15365) | 3434444..3434749 | - | 306 | WP_256608987.1 | putative addiction module antidote protein | Antitoxin |
| PL263_RS15375 (PL263_15370) | 3434753..3435049 | - | 297 | WP_256608988.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PL263_RS15380 (PL263_15375) | 3435089..3436105 | - | 1017 | WP_278210154.1 | anthranilate phosphoribosyltransferase | - |
| PL263_RS15385 (PL263_15380) | 3436235..3437425 | - | 1191 | WP_278210155.1 | trans-2-enoyl-CoA reductase family protein | - |
| PL263_RS15390 (PL263_15385) | 3437734..3438342 | + | 609 | WP_278210156.1 | discoidin domain-containing protein | - |
| PL263_RS15395 (PL263_15390) | 3438631..3439026 | - | 396 | WP_278210157.1 | hypothetical protein | - |
| PL263_RS15400 (PL263_15395) | 3439112..3439780 | - | 669 | WP_278210158.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10940.64 Da Isoelectric Point: 8.0276
>T268640 WP_256608988.1 NZ_CP116398:c3435049-3434753 [Methylomonas sp. EFPC3]
MYTIKQLPAFSEWLFGLKDGLTHRRLARRLEKAQQGNLGDVKAVGEGVFEMREHFGPGWRMYYVQRGEVLIVMLGGGDKS
SQAADIAKAQCLAALLED
MYTIKQLPAFSEWLFGLKDGLTHRRLARRLEKAQQGNLGDVKAVGEGVFEMREHFGPGWRMYYVQRGEVLIVMLGGGDKS
SQAADIAKAQCLAALLED
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|