Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 12252..12891 | Replicon | chromosome |
Accession | NZ_CP116398 | ||
Organism | Methylomonas sp. EFPC3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PL263_RS00060 | Protein ID | WP_278211098.1 |
Coordinates | 12252..12653 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A291IN90 |
Locus tag | PL263_RS00065 | Protein ID | WP_054761998.1 |
Coordinates | 12658..12891 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL263_RS00045 (PL263_00045) | 9585..10469 | + | 885 | WP_278211095.1 | LysR family transcriptional regulator | - |
PL263_RS00050 (PL263_00050) | 10766..11011 | + | 246 | WP_278211096.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
PL263_RS00055 (PL263_00055) | 11011..11322 | + | 312 | WP_278211097.1 | CcdB family protein | - |
PL263_RS00060 (PL263_00060) | 12252..12653 | - | 402 | WP_278211098.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PL263_RS00065 (PL263_00065) | 12658..12891 | - | 234 | WP_054761998.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PL263_RS00070 (PL263_00070) | 13053..13466 | - | 414 | WP_278211100.1 | type II toxin-antitoxin system VapC family toxin | - |
PL263_RS00075 (PL263_00075) | 13463..13717 | - | 255 | WP_278211102.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
PL263_RS00080 (PL263_00080) | 14255..17149 | + | 2895 | WP_278211103.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14844.24 Da Isoelectric Point: 8.9485
>T268635 WP_278211098.1 NZ_CP116398:c12653-12252 [Methylomonas sp. EFPC3]
VLKYLLDTNIVIYVIKRRPIEVLATFNRHHGRMAISAVTLAELIHGAEKSQFPARNLATVEDFCSRLQVLPYNDSAALHY
GGIRAALEKIGQPIGVNDLHIAAHARSHGLILVSNNLREFARVPGLLMENWLE
VLKYLLDTNIVIYVIKRRPIEVLATFNRHHGRMAISAVTLAELIHGAEKSQFPARNLATVEDFCSRLQVLPYNDSAALHY
GGIRAALEKIGQPIGVNDLHIAAHARSHGLILVSNNLREFARVPGLLMENWLE
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|