Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 868759..869242 Replicon chromosome
Accession NZ_CP116393
Organism Streptococcus suis strain SS/UPM/MY/F001

Toxin (Protein)


Gene name relE Uniprot ID A0A4P7WQV5
Locus tag PFZ59_RS04600 Protein ID WP_024391431.1
Coordinates 868982..869242 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4T2HAA1
Locus tag PFZ59_RS04595 Protein ID WP_024391430.1
Coordinates 868759..868980 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PFZ59_RS04575 (PFZ59_04575) 864662..865714 + 1053 WP_277697604.1 3-isopropylmalate dehydrogenase -
PFZ59_RS04580 (PFZ59_04580) 865711..867102 + 1392 WP_277697605.1 3-isopropylmalate dehydratase large subunit -
PFZ59_RS04585 (PFZ59_04585) 867102..867695 + 594 WP_208581920.1 3-isopropylmalate dehydratase small subunit -
PFZ59_RS04590 (PFZ59_04590) 867862..868647 + 786 WP_208581919.1 Sua5/YciO/YrdC/YwlC family protein -
PFZ59_RS04595 (PFZ59_04595) 868759..868980 + 222 WP_024391430.1 DUF6290 family protein Antitoxin
PFZ59_RS04600 (PFZ59_04600) 868982..869242 + 261 WP_024391431.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PFZ59_RS04605 (PFZ59_04605) 869534..870394 - 861 WP_277697606.1 helix-turn-helix transcriptional regulator -
PFZ59_RS04610 (PFZ59_04610) 870596..870721 + 126 WP_277697607.1 hypothetical protein -
PFZ59_RS04615 (PFZ59_04615) 870763..871053 + 291 WP_136581578.1 lactococcin 972 family bacteriocin -
PFZ59_RS04620 (PFZ59_04620) 871115..873136 + 2022 WP_277697608.1 DUF1430 domain-containing protein -
PFZ59_RS04625 (PFZ59_04625) 873138..873770 + 633 WP_277697609.1 ABC transporter ATP-binding protein -
PFZ59_RS04630 (PFZ59_04630) 873968..874180 + 213 WP_024398515.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10350.93 Da        Isoelectric Point: 9.8183

>T268632 WP_024391431.1 NZ_CP116393:868982-869242 [Streptococcus suis]
MFHVEYSKKAQKQIRKLDKQIQRLLFAWVDKHLDGTVNPRLHGKGLTGDHANEWRYRIGDYRLICDIQDDRMVILALEFG
HRRDIY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8596.58 Da        Isoelectric Point: 4.4915

>AT268632 WP_024391430.1 NZ_CP116393:868759-868980 [Streptococcus suis]
MSTVTIRLNKEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLSIYHQAYEEYQKDPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7WQV5

Antitoxin

Source ID Structure
AlphaFold DB A0A4T2HAA1

References