Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 448706..449359 | Replicon | chromosome |
| Accession | NZ_CP116387 | ||
| Organism | Acinetobacter baumannii strain WM98 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B0V6V2 |
| Locus tag | PIG43_RS02170 | Protein ID | WP_000931890.1 |
| Coordinates | 448970..449359 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | PIG43_RS02165 | Protein ID | WP_001288210.1 |
| Coordinates | 448706..448963 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIG43_RS02145 (PIG43_02145) | 444222..445229 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| PIG43_RS02150 (PIG43_02150) | 445248..445625 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| PIG43_RS02155 (PIG43_02155) | 445806..447296 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PIG43_RS02160 (PIG43_02160) | 447346..448518 | - | 1173 | WP_001190546.1 | acyl-CoA dehydrogenase family protein | - |
| PIG43_RS02165 (PIG43_02165) | 448706..448963 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| PIG43_RS02170 (PIG43_02170) | 448970..449359 | + | 390 | WP_000931890.1 | membrane protein | Toxin |
| PIG43_RS02175 (PIG43_02175) | 450129..451214 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| PIG43_RS02180 (PIG43_02180) | 451292..451858 | + | 567 | WP_000651536.1 | rhombosortase | - |
| PIG43_RS02185 (PIG43_02185) | 452046..454241 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.98 Da Isoelectric Point: 10.4623
>T268626 WP_000931890.1 NZ_CP116387:448970-449359 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1A4U0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |