Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 1886688..1887454 | Replicon | chromosome |
Accession | NZ_CP116383 | ||
Organism | Vibrio sp. SCSIO 43137 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PK654_RS08810 | Protein ID | WP_271695207.1 |
Coordinates | 1886688..1887185 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PK654_RS08815 | Protein ID | WP_271695209.1 |
Coordinates | 1887182..1887454 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PK654_RS08780 (PK654_08780) | 1881877..1882116 | + | 240 | WP_271695198.1 | RNA-binding protein | - |
PK654_RS08785 (PK654_08785) | 1882163..1882993 | - | 831 | WP_271695199.1 | hypothetical protein | - |
PK654_RS08790 (PK654_08790) | 1883129..1883647 | - | 519 | WP_271695200.1 | GNAT family N-acetyltransferase | - |
PK654_RS08795 (PK654_08795) | 1883941..1884858 | - | 918 | WP_271695202.1 | AraC family transcriptional regulator | - |
PK654_RS08800 (PK654_08800) | 1885177..1885575 | + | 399 | WP_271695204.1 | hypothetical protein | - |
PK654_RS08805 (PK654_08805) | 1885619..1886548 | + | 930 | WP_271695205.1 | alpha/beta hydrolase | - |
PK654_RS08810 (PK654_08810) | 1886688..1887185 | - | 498 | WP_271695207.1 | GNAT family N-acetyltransferase | Toxin |
PK654_RS08815 (PK654_08815) | 1887182..1887454 | - | 273 | WP_271695209.1 | DUF1778 domain-containing protein | Antitoxin |
PK654_RS08820 (PK654_08820) | 1887895..1888344 | - | 450 | WP_271695211.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
PK654_RS08825 (PK654_08825) | 1888467..1888988 | + | 522 | WP_271695213.1 | disulfide bond formation protein B | - |
PK654_RS08830 (PK654_08830) | 1888975..1889607 | + | 633 | WP_271695215.1 | thioredoxin domain-containing protein | - |
PK654_RS08835 (PK654_08835) | 1889902..1890126 | - | 225 | WP_271695216.1 | VF530 family protein | - |
PK654_RS08840 (PK654_08840) | 1890424..1890933 | + | 510 | WP_271695217.1 | hypothetical protein | - |
PK654_RS08845 (PK654_08845) | 1890930..1891532 | - | 603 | WP_271695219.1 | methyltransferase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18520.33 Da Isoelectric Point: 9.5422
>T268621 WP_271695207.1 NZ_CP116383:c1887185-1886688 [Vibrio sp. SCSIO 43137]
MMNTVLLDKAKHDRNRFNCGIDALNNHLKVMASQQAKKDNSRTFVLEDDNNNSYIVGFYTLTMAPIDLKALPDKLQKMHQ
SSTSGGLIARLVVDERYKGKGLGEWLLIDALRKLLAASDSVAFPIVIVDAKDGAKQFYERYGFKAFQYAENKLFITISDV
RASLA
MMNTVLLDKAKHDRNRFNCGIDALNNHLKVMASQQAKKDNSRTFVLEDDNNNSYIVGFYTLTMAPIDLKALPDKLQKMHQ
SSTSGGLIARLVVDERYKGKGLGEWLLIDALRKLLAASDSVAFPIVIVDAKDGAKQFYERYGFKAFQYAENKLFITISDV
RASLA
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|