Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 1274750..1275269 | Replicon | chromosome |
| Accession | NZ_CP116383 | ||
| Organism | Vibrio sp. SCSIO 43137 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PK654_RS05995 | Protein ID | WP_271698292.1 |
| Coordinates | 1274750..1275034 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | PK654_RS06000 | Protein ID | WP_271698818.1 |
| Coordinates | 1275027..1275269 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PK654_RS05985 (PK654_05985) | 1272050..1272991 | + | 942 | WP_271698290.1 | sensor domain-containing diguanylate cyclase | - |
| PK654_RS05990 (PK654_05990) | 1273397..1274647 | + | 1251 | WP_271698291.1 | DEAD/DEAH box helicase | - |
| PK654_RS05995 (PK654_05995) | 1274750..1275034 | - | 285 | WP_271698292.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PK654_RS06000 (PK654_06000) | 1275027..1275269 | - | 243 | WP_271698818.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PK654_RS06005 (PK654_06005) | 1275437..1277437 | - | 2001 | WP_271698293.1 | methyl-accepting chemotaxis protein | - |
| PK654_RS06010 (PK654_06010) | 1277773..1278306 | + | 534 | WP_271698294.1 | molybdopterin adenylyltransferase | - |
| PK654_RS06015 (PK654_06015) | 1278508..1279125 | + | 618 | WP_271698295.1 | DsbA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11228.90 Da Isoelectric Point: 6.9771
>T268619 WP_271698292.1 NZ_CP116383:c1275034-1274750 [Vibrio sp. SCSIO 43137]
MYKLSQKAAEDFGNIYEYTFLNFGEDQADKYTDELESVLKTISEAPFIGRVCDDMKAGIRRHEHHKHSIFYRIRKVDIFI
VRILHQQMNPMLYL
MYKLSQKAAEDFGNIYEYTFLNFGEDQADKYTDELESVLKTISEAPFIGRVCDDMKAGIRRHEHHKHSIFYRIRKVDIFI
VRILHQQMNPMLYL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|