Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
| Location | 3302..4099 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP116350 | ||
| Organism | Enterobacter ludwigii strain CM-TZ4 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | F5S3R9 |
| Locus tag | PHA72_RS27710 | Protein ID | WP_006812498.1 |
| Coordinates | 3575..4099 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A5D4NAG3 |
| Locus tag | PHA72_RS27705 | Protein ID | WP_016582626.1 |
| Coordinates | 3302..3571 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA72_RS27685 (PHA72_27680) | 1..1056 | + | 1056 | WP_059306389.1 | hypothetical protein | - |
| PHA72_RS27690 (PHA72_27685) | 1122..1847 | - | 726 | WP_059306388.1 | DUF2971 domain-containing protein | - |
| PHA72_RS27695 (PHA72_27690) | 1900..2253 | - | 354 | WP_161574040.1 | hypothetical protein | - |
| PHA72_RS27700 (PHA72_27695) | 2259..2924 | - | 666 | WP_059306387.1 | AAA family ATPase | - |
| PHA72_RS27705 (PHA72_27700) | 3302..3571 | + | 270 | WP_016582626.1 | DUF1778 domain-containing protein | Antitoxin |
| PHA72_RS27710 (PHA72_27705) | 3575..4099 | + | 525 | WP_006812498.1 | GNAT family N-acetyltransferase | Toxin |
| PHA72_RS27715 (PHA72_27710) | 4284..4535 | - | 252 | WP_000147960.1 | hypothetical protein | - |
| PHA72_RS27720 (PHA72_27715) | 4537..5229 | - | 693 | WP_059306812.1 | hypothetical protein | - |
| PHA72_RS27725 (PHA72_27720) | 5243..5566 | - | 324 | WP_000064173.1 | hypothetical protein | - |
| PHA72_RS27730 (PHA72_27725) | 5641..6363 | - | 723 | WP_081051074.1 | receptor-recognizing protein | - |
| PHA72_RS27735 (PHA72_27730) | 6401..6961 | - | 561 | Protein_10 | hypothetical protein | - |
| PHA72_RS27740 (PHA72_27735) | 7036..7419 | - | 384 | WP_000469441.1 | minor capsid protein | - |
| PHA72_RS27745 (PHA72_27740) | 7421..7894 | - | 474 | WP_000523626.1 | hypothetical protein | - |
| PHA72_RS27750 (PHA72_27745) | 7885..8229 | - | 345 | WP_001027662.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..61089 | 61089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19356.13 Da Isoelectric Point: 8.9844
>T268616 WP_006812498.1 NZ_CP116350:3575-4099 [Enterobacter ludwigii]
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QWY8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5D4NAG3 |