Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4174290..4174947 | Replicon | chromosome |
Accession | NZ_CP116347 | ||
Organism | Enterobacter ludwigii strain CM-TZ4 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | G8LDB6 |
Locus tag | PHA72_RS20540 | Protein ID | WP_014171514.1 |
Coordinates | 4174290..4174700 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | PHA72_RS20545 | Protein ID | WP_003863437.1 |
Coordinates | 4174681..4174947 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA72_RS20520 (PHA72_20515) | 4170288..4172021 | - | 1734 | WP_044866092.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PHA72_RS20525 (PHA72_20520) | 4172027..4172740 | - | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PHA72_RS20530 (PHA72_20525) | 4172764..4173660 | - | 897 | WP_050737268.1 | site-specific tyrosine recombinase XerD | - |
PHA72_RS20535 (PHA72_20530) | 4173762..4174283 | + | 522 | WP_059306190.1 | flavodoxin FldB | - |
PHA72_RS20540 (PHA72_20535) | 4174290..4174700 | - | 411 | WP_014171514.1 | protein YgfX | Toxin |
PHA72_RS20545 (PHA72_20540) | 4174681..4174947 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
PHA72_RS20550 (PHA72_20545) | 4175242..4176222 | + | 981 | WP_020883730.1 | tRNA-modifying protein YgfZ | - |
PHA72_RS20555 (PHA72_20550) | 4176333..4176992 | - | 660 | WP_014171517.1 | hemolysin III family protein | - |
PHA72_RS20560 (PHA72_20555) | 4177259..4177990 | + | 732 | WP_040018863.1 | MurR/RpiR family transcriptional regulator | - |
PHA72_RS20565 (PHA72_20560) | 4178107..4179540 | + | 1434 | WP_020883728.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16217.15 Da Isoelectric Point: 11.5020
>T268611 WP_014171514.1 NZ_CP116347:c4174700-4174290 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839BUV6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |