Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1580759..1581444 | Replicon | chromosome |
| Accession | NZ_CP116342 | ||
| Organism | Neisseria gonorrhoeae strain SE690. | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | PH604_RS08195 | Protein ID | WP_003689143.1 |
| Coordinates | 1581262..1581444 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | PH604_RS08190 | Protein ID | WP_003691454.1 |
| Coordinates | 1580759..1581160 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH604_RS08135 (PH604_08105) | 1575816..1576031 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| PH604_RS08140 (PH604_08110) | 1576083..1576574 | - | 492 | WP_017147227.1 | siphovirus Gp157 family protein | - |
| PH604_RS08145 (PH604_08115) | 1576571..1576753 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| PH604_RS08150 (PH604_08120) | 1576893..1577579 | - | 687 | WP_033910330.1 | hypothetical protein | - |
| PH604_RS08155 (PH604_08125) | 1577648..1577809 | - | 162 | WP_004464809.1 | hypothetical protein | - |
| PH604_RS08160 (PH604_08130) | 1577806..1578081 | - | 276 | WP_010359972.1 | hypothetical protein | - |
| PH604_RS08165 (PH604_08135) | 1578234..1578566 | - | 333 | WP_047919601.1 | phage associated protein | - |
| PH604_RS08170 (PH604_08140) | 1578707..1578982 | - | 276 | WP_192212651.1 | hypothetical protein | - |
| PH604_RS08175 (PH604_08145) | 1578979..1579455 | - | 477 | WP_002255718.1 | hypothetical protein | - |
| PH604_RS08180 (PH604_08150) | 1579488..1579688 | - | 201 | WP_048654497.1 | hypothetical protein | - |
| PH604_RS08185 (PH604_08155) | 1579899..1580660 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| PH604_RS08190 (PH604_08160) | 1580759..1581160 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PH604_RS08195 (PH604_08165) | 1581262..1581444 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PH604_RS08200 (PH604_08170) | 1581614..1582432 | - | 819 | WP_012503752.1 | DUF3037 domain-containing protein | - |
| PH604_RS08205 (PH604_08175) | 1582429..1583127 | - | 699 | WP_003689139.1 | hypothetical protein | - |
| PH604_RS08210 (PH604_08180) | 1583366..1584076 | - | 711 | WP_050161643.1 | helix-turn-helix transcriptional regulator | - |
| PH604_RS08215 (PH604_08185) | 1584192..1584380 | + | 189 | WP_003689136.1 | helix-turn-helix domain-containing protein | - |
| PH604_RS08220 (PH604_08190) | 1584460..1584615 | + | 156 | WP_003691446.1 | hypothetical protein | - |
| PH604_RS08225 (PH604_08195) | 1584592..1584780 | - | 189 | WP_003706568.1 | hypothetical protein | - |
| PH604_RS08230 (PH604_08200) | 1584953..1585180 | + | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| PH604_RS08235 (PH604_08205) | 1585298..1586362 | + | 1065 | WP_003689134.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1565588..1599845 | 34257 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T268602 WP_003689143.1 NZ_CP116342:c1581444-1581262 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT268602 WP_003691454.1 NZ_CP116342:c1581160-1580759 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|