Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 889604..890259 | Replicon | chromosome |
Accession | NZ_CP116342 | ||
Organism | Neisseria gonorrhoeae strain SE690. |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | PH604_RS04585 | Protein ID | WP_003691083.1 |
Coordinates | 889604..890023 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | PH604_RS04590 | Protein ID | WP_003688410.1 |
Coordinates | 890023..890259 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH604_RS04565 (PH604_04550) | 884838..886379 | - | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
PH604_RS04570 (PH604_04555) | 886527..887306 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
PH604_RS04575 (PH604_04560) | 887303..888004 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
PH604_RS04580 (PH604_04565) | 888001..889455 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
PH604_RS04585 (PH604_04570) | 889604..890023 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
PH604_RS04590 (PH604_04575) | 890023..890259 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
PH604_RS04595 (PH604_04580) | 890707..891285 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
PH604_RS04600 (PH604_04585) | 891290..891691 | - | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
PH604_RS04605 (PH604_04590) | 891930..892316 | + | 387 | Protein_903 | IS110 family transposase | - |
PH604_RS04610 (PH604_04595) | 892699..893589 | - | 891 | WP_272656726.1 | succinate--CoA ligase subunit alpha | - |
PH604_RS04615 (PH604_04600) | 893600..894766 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
PH604_RS04620 (PH604_04605) | 894838..895125 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T268601 WP_003691083.1 NZ_CP116342:c890023-889604 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|