Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3666223..3666866 | Replicon | chromosome |
Accession | NZ_CP116340 | ||
Organism | Pseudomonas sp. JBR1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PJ259_RS16990 | Protein ID | WP_271653593.1 |
Coordinates | 3666453..3666866 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PJ259_RS16985 | Protein ID | WP_271653592.1 |
Coordinates | 3666223..3666453 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJ259_RS16965 (PJ259_16965) | 3661457..3661873 | - | 417 | WP_271653588.1 | organic hydroperoxide resistance protein | - |
PJ259_RS16970 (PJ259_16970) | 3662019..3662453 | - | 435 | WP_271653589.1 | MarR family transcriptional regulator | - |
PJ259_RS16975 (PJ259_16975) | 3662541..3664058 | + | 1518 | WP_271653590.1 | sigma-54-dependent transcriptional regulator | - |
PJ259_RS16980 (PJ259_16980) | 3664206..3665930 | - | 1725 | WP_271653591.1 | ubiquinone-dependent pyruvate dehydrogenase | - |
PJ259_RS16985 (PJ259_16985) | 3666223..3666453 | + | 231 | WP_271653592.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PJ259_RS16990 (PJ259_16990) | 3666453..3666866 | + | 414 | WP_271653593.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PJ259_RS16995 (PJ259_16995) | 3667168..3667536 | + | 369 | WP_271653594.1 | glycine cleavage system protein GcvH | - |
PJ259_RS17000 (PJ259_17000) | 3667544..3670399 | + | 2856 | WP_271653595.1 | aminomethyl-transferring glycine dehydrogenase | - |
PJ259_RS17005 (PJ259_17005) | 3670659..3671768 | + | 1110 | WP_271653596.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15256.51 Da Isoelectric Point: 7.9082
>T268600 WP_271653593.1 NZ_CP116340:3666453-3666866 [Pseudomonas sp. JBR1]
MLKFMLDTNTCIFTIKNRPESVREAFTRHHGQLCISTVTLMELIYGAEKSSSPERNLAVVEGFAARLEVLKYGLEAAAHT
GQLRAELARAGQQIGPYDQMIAGHARSLGLIVVTNNRREFDRVPGLRVEDWVTAEKG
MLKFMLDTNTCIFTIKNRPESVREAFTRHHGQLCISTVTLMELIYGAEKSSSPERNLAVVEGFAARLEVLKYGLEAAAHT
GQLRAELARAGQQIGPYDQMIAGHARSLGLIVVTNNRREFDRVPGLRVEDWVTAEKG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|