Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 547510..548075 | Replicon | chromosome |
Accession | NZ_CP116339 | ||
Organism | Pseudoxanthomonas sp. JBR18 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PJ250_RS02660 | Protein ID | WP_271647017.1 |
Coordinates | 547510..547830 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PJ250_RS02665 | Protein ID | WP_271647018.1 |
Coordinates | 547818..548075 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJ250_RS02645 (PJ250_02645) | 542828..543541 | + | 714 | WP_271647014.1 | SDR family oxidoreductase | - |
PJ250_RS02650 (PJ250_02650) | 544483..544905 | - | 423 | WP_271647015.1 | Dabb family protein | - |
PJ250_RS02655 (PJ250_02655) | 545344..547272 | - | 1929 | WP_271647016.1 | alpha-L-fucosidase | - |
PJ250_RS02660 (PJ250_02660) | 547510..547830 | - | 321 | WP_271647017.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PJ250_RS02665 (PJ250_02665) | 547818..548075 | - | 258 | WP_271647018.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PJ250_RS02670 (PJ250_02670) | 548437..548910 | - | 474 | WP_271648498.1 | RNA polymerase sigma factor | - |
PJ250_RS02675 (PJ250_02675) | 549120..549920 | - | 801 | WP_271647019.1 | hypothetical protein | - |
PJ250_RS02680 (PJ250_02680) | 550283..550636 | - | 354 | WP_271647020.1 | hypothetical protein | - |
PJ250_RS02685 (PJ250_02685) | 551133..551558 | - | 426 | WP_271647021.1 | hypothetical protein | - |
PJ250_RS02690 (PJ250_02690) | 552321..552611 | - | 291 | WP_271647022.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 540576..561386 | 20810 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11952.78 Da Isoelectric Point: 8.0706
>T268599 WP_271647017.1 NZ_CP116339:c547830-547510 [Pseudoxanthomonas sp. JBR18]
MAEIVWSEPALSDLDAIADYIALESPVAASELVKRIFGHVEQLADHPESGSRPPELGKSRYRQIVEPPCRVFYRYDGHKV
FVLHVMRSERLLRKGPLAARSKQVGI
MAEIVWSEPALSDLDAIADYIALESPVAASELVKRIFGHVEQLADHPESGSRPPELGKSRYRQIVEPPCRVFYRYDGHKV
FVLHVMRSERLLRKGPLAARSKQVGI
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|