Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 5097150..5097792 | Replicon | chromosome |
| Accession | NZ_CP116325 | ||
| Organism | Bacillus thuringiensis strain BLB1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | PJW01_RS26635 | Protein ID | WP_000635965.1 |
| Coordinates | 5097442..5097792 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | PJW01_RS26630 | Protein ID | WP_000004570.1 |
| Coordinates | 5097150..5097437 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJW01_RS26605 (PJW01_26605) | 5092467..5093429 | + | 963 | WP_000961167.1 | UV DNA damage repair endonuclease UvsE | - |
| PJW01_RS26610 (PJW01_26610) | 5093422..5093994 | - | 573 | WP_000908522.1 | rhomboid family intramembrane serine protease | - |
| PJW01_RS26615 (PJW01_26615) | 5094088..5094447 | + | 360 | WP_000583417.1 | holo-ACP synthase | - |
| PJW01_RS26620 (PJW01_26620) | 5094604..5095554 | + | 951 | WP_002100659.1 | outer membrane lipoprotein carrier protein LolA | - |
| PJW01_RS26625 (PJW01_26625) | 5095672..5096841 | + | 1170 | WP_000390616.1 | alanine racemase | - |
| PJW01_RS26630 (PJW01_26630) | 5097150..5097437 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| PJW01_RS26635 (PJW01_26635) | 5097442..5097792 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PJW01_RS26640 (PJW01_26640) | 5097860..5100028 | + | 2169 | WP_000426236.1 | Tex family protein | - |
| PJW01_RS26645 (PJW01_26645) | 5100087..5100203 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| PJW01_RS26650 (PJW01_26650) | 5100399..5100857 | + | 459 | WP_000344239.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T268594 WP_000635965.1 NZ_CP116325:5097442-5097792 [Bacillus thuringiensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |