Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 1776823..1777801 | Replicon | chromosome |
| Accession | NZ_CP116325 | ||
| Organism | Bacillus thuringiensis strain BLB1 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | PJW01_RS09455 | Protein ID | WP_000624977.1 |
| Coordinates | 1776823..1777560 (+) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W8YZL5 |
| Locus tag | PJW01_RS09460 | Protein ID | WP_000237818.1 |
| Coordinates | 1777673..1777801 (+) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJW01_RS09435 (PJW01_09435) | 1772466..1773248 | + | 783 | WP_000381800.1 | class I SAM-dependent methyltransferase | - |
| PJW01_RS09440 (PJW01_09440) | 1773406..1775091 | - | 1686 | WP_003284281.1 | alpha-keto acid decarboxylase family protein | - |
| PJW01_RS09445 (PJW01_09445) | 1775199..1775681 | + | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PJW01_RS09450 (PJW01_09450) | 1775848..1776585 | + | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| PJW01_RS09455 (PJW01_09455) | 1776823..1777560 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| PJW01_RS09460 (PJW01_09460) | 1777673..1777801 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
| PJW01_RS09465 (PJW01_09465) | 1777874..1778050 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| PJW01_RS09470 (PJW01_09470) | 1778069..1778458 | - | 390 | WP_000713866.1 | YxeA family protein | - |
| PJW01_RS09475 (PJW01_09475) | 1778670..1780139 | + | 1470 | WP_000287515.1 | beta-Ala-His dipeptidase | - |
| PJW01_RS09480 (PJW01_09480) | 1780385..1781194 | + | 810 | WP_000678509.1 | papain-like cysteine protease family protein | - |
| PJW01_RS09485 (PJW01_09485) | 1781220..1781822 | + | 603 | WP_000517260.1 | hypothetical protein | - |
| PJW01_RS09490 (PJW01_09490) | 1782062..1782313 | - | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T268593 WP_000624977.1 NZ_CP116325:1776823-1777560 [Bacillus thuringiensis]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|