Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 3484571..3485549 | Replicon | chromosome |
| Accession | NZ_CP116313 | ||
| Organism | Bacillus thuringiensis strain Lip | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | PJW02_RS18000 | Protein ID | WP_000624977.1 |
| Coordinates | 3484812..3485549 (-) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W8YZL5 |
| Locus tag | PJW02_RS17995 | Protein ID | WP_000237818.1 |
| Coordinates | 3484571..3484699 (-) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJW02_RS17965 (PJW02_17965) | 3480059..3480310 | + | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
| PJW02_RS17970 (PJW02_17970) | 3480550..3481152 | - | 603 | WP_000517260.1 | hypothetical protein | - |
| PJW02_RS17975 (PJW02_17975) | 3481178..3481987 | - | 810 | WP_000678509.1 | papain-like cysteine protease family protein | - |
| PJW02_RS17980 (PJW02_17980) | 3482233..3483702 | - | 1470 | WP_000287515.1 | beta-Ala-His dipeptidase | - |
| PJW02_RS17985 (PJW02_17985) | 3483914..3484303 | + | 390 | WP_000713866.1 | YxeA family protein | - |
| PJW02_RS17990 (PJW02_17990) | 3484322..3484498 | - | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| PJW02_RS17995 (PJW02_17995) | 3484571..3484699 | - | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
| PJW02_RS18000 (PJW02_18000) | 3484812..3485549 | - | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| PJW02_RS18005 (PJW02_18005) | 3485787..3486524 | - | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| PJW02_RS18010 (PJW02_18010) | 3486691..3487173 | - | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PJW02_RS18015 (PJW02_18015) | 3487281..3488966 | + | 1686 | WP_003284281.1 | alpha-keto acid decarboxylase family protein | - |
| PJW02_RS18020 (PJW02_18020) | 3489124..3489906 | - | 783 | WP_000381800.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T268588 WP_000624977.1 NZ_CP116313:c3485549-3484812 [Bacillus thuringiensis]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|