Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 179523..180165 | Replicon | chromosome |
Accession | NZ_CP116313 | ||
Organism | Bacillus thuringiensis strain Lip |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | PJW02_RS00930 | Protein ID | WP_000635965.1 |
Coordinates | 179523..179873 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | PJW02_RS00935 | Protein ID | WP_000004570.1 |
Coordinates | 179878..180165 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJW02_RS00915 (PJW02_00915) | 176458..176916 | - | 459 | WP_000344239.1 | SprT family protein | - |
PJW02_RS00920 (PJW02_00920) | 177112..177228 | + | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
PJW02_RS00925 (PJW02_00925) | 177287..179455 | - | 2169 | WP_000426236.1 | Tex family protein | - |
PJW02_RS00930 (PJW02_00930) | 179523..179873 | - | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PJW02_RS00935 (PJW02_00935) | 179878..180165 | - | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
PJW02_RS00940 (PJW02_00940) | 180474..181643 | - | 1170 | WP_000390616.1 | alanine racemase | - |
PJW02_RS00945 (PJW02_00945) | 181761..182711 | - | 951 | WP_002100659.1 | outer membrane lipoprotein carrier protein LolA | - |
PJW02_RS00950 (PJW02_00950) | 182868..183227 | - | 360 | WP_000583417.1 | holo-ACP synthase | - |
PJW02_RS00955 (PJW02_00955) | 183321..183893 | + | 573 | WP_000908522.1 | rhomboid family intramembrane serine protease | - |
PJW02_RS00960 (PJW02_00960) | 183886..184848 | - | 963 | WP_000961167.1 | UV DNA damage repair endonuclease UvsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T268587 WP_000635965.1 NZ_CP116313:c179873-179523 [Bacillus thuringiensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |