Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/FR47-DUF1778 |
Location | 11251..12047 | Replicon | plasmid pGEV872.3 |
Accession | NZ_CP116308 | ||
Organism | Xanthomonas perforans strain GEV872 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A6L9VEW6 |
Locus tag | PJW04_RS22535 | Protein ID | WP_033836093.1 |
Coordinates | 11538..12047 (+) | Length | 170 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A6P0G6J6 |
Locus tag | PJW04_RS22530 | Protein ID | WP_017154722.1 |
Coordinates | 11251..11541 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJW04_RS22490 (PJW04_22490) | 6496..6741 | - | 246 | WP_046932153.1 | hypothetical protein | - |
PJW04_RS22495 (PJW04_22495) | 7025..8452 | - | 1428 | WP_046932154.1 | hypothetical protein | - |
PJW04_RS22500 (PJW04_22500) | 8652..8987 | - | 336 | WP_040279228.1 | ParC family partition-associated protein | - |
PJW04_RS22505 (PJW04_22505) | 9093..9317 | - | 225 | WP_040279226.1 | plasmid partition protein ParG | - |
PJW04_RS22510 (PJW04_22510) | 9338..9967 | - | 630 | WP_017154718.1 | ParA family partition ATPase | - |
PJW04_RS22515 (PJW04_22515) | 10045..10602 | - | 558 | WP_017154719.1 | recombinase family protein | - |
PJW04_RS22520 (PJW04_22520) | 10605..10742 | - | 138 | WP_017154720.1 | hypothetical protein | - |
PJW04_RS22525 (PJW04_22525) | 10771..10980 | - | 210 | WP_228996802.1 | hypothetical protein | - |
PJW04_RS22530 (PJW04_22530) | 11251..11541 | + | 291 | WP_017154722.1 | DUF1778 domain-containing protein | Antitoxin |
PJW04_RS22535 (PJW04_22535) | 11538..12047 | + | 510 | WP_033836093.1 | GNAT family N-acetyltransferase | Toxin |
PJW04_RS22540 (PJW04_22540) | 12044..12310 | + | 267 | WP_033836092.1 | hypothetical protein | - |
PJW04_RS22545 (PJW04_22545) | 12605..13093 | - | 489 | WP_228996803.1 | hypothetical protein | - |
PJW04_RS22550 (PJW04_22550) | 13096..13356 | - | 261 | WP_228996804.1 | hypothetical protein | - |
PJW04_RS22555 (PJW04_22555) | 13353..15791 | - | 2439 | WP_046932161.1 | relaxase/mobilization nuclease domain-containing protein | - |
PJW04_RS22560 (PJW04_22560) | 15781..16176 | - | 396 | WP_017154702.1 | plasmid mobilization protein MobA | - |
PJW04_RS22565 (PJW04_22565) | 16575..16880 | + | 306 | WP_017154703.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..18815 | 18815 | |
- | flank | IS/Tn | - | - | 10045..10602 | 557 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 170 a.a. Molecular weight: 18189.82 Da Isoelectric Point: 8.0537
>T268586 WP_033836093.1 NZ_CP116308:11538-12047 [Xanthomonas perforans]
MKVSAPEPLAAHHDIEAFDSGVDSLDQWLKRRALKNQATGASRTFVACDDGRVVAYYALASSGVTVDAAPGRFRRNMPDP
IPVVVLGRLAVDQSQQGRGLGRALVKDAGQRIVQAADTIGIRGVLVHALSADAKAFYERIGFEPSPLDPMMLLVTLDDLK
ASLEPQARR
MKVSAPEPLAAHHDIEAFDSGVDSLDQWLKRRALKNQATGASRTFVACDDGRVVAYYALASSGVTVDAAPGRFRRNMPDP
IPVVVLGRLAVDQSQQGRGLGRALVKDAGQRIVQAADTIGIRGVLVHALSADAKAFYERIGFEPSPLDPMMLLVTLDDLK
ASLEPQARR
Download Length: 510 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L9VEW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P0G6J6 |