Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 69354..69901 | Replicon | chromosome |
Accession | NZ_CP116305 | ||
Organism | Xanthomonas perforans strain GEV872 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0G9C4Q2 |
Locus tag | PJW04_RS00275 | Protein ID | WP_008574054.1 |
Coordinates | 69599..69901 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q3BZM5 |
Locus tag | PJW04_RS00270 | Protein ID | WP_008574056.1 |
Coordinates | 69354..69611 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJW04_RS00255 (PJW04_00255) | 64499..65956 | - | 1458 | WP_008574059.1 | ribonuclease H-like domain-containing protein | - |
PJW04_RS00260 (PJW04_00260) | 65953..68448 | - | 2496 | WP_046932047.1 | DEAD/DEAH box helicase | - |
PJW04_RS00265 (PJW04_00265) | 68626..69288 | + | 663 | WP_008574057.1 | hemolysin III family protein | - |
PJW04_RS00270 (PJW04_00270) | 69354..69611 | + | 258 | WP_008574056.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PJW04_RS00275 (PJW04_00275) | 69599..69901 | + | 303 | WP_008574054.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PJW04_RS00285 (PJW04_00285) | 70083..70982 | - | 900 | WP_008574052.1 | SDR family NAD(P)-dependent oxidoreductase | - |
PJW04_RS00290 (PJW04_00290) | 71042..71779 | - | 738 | WP_008574050.1 | SDR family oxidoreductase | - |
PJW04_RS00295 (PJW04_00295) | 71905..72816 | + | 912 | WP_033478804.1 | LysR family transcriptional regulator | - |
PJW04_RS00300 (PJW04_00300) | 73016..73726 | + | 711 | WP_008574047.1 | hypothetical protein | - |
PJW04_RS00305 (PJW04_00305) | 73964..74572 | - | 609 | WP_008574046.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11522.33 Da Isoelectric Point: 9.1267
>T268584 WP_008574054.1 NZ_CP116305:69599-69901 [Xanthomonas perforans]
MAEIIWSVPALADLDAIADDIAIDNAPAAAAALVKWVLPQVERLIEHPDSGSRPQELQRSRYRQIVEPPCRVFYRVDGQR
IVLVHVMRWERALRRNRLSR
MAEIIWSVPALADLDAIADDIAIDNAPAAAAALVKWVLPQVERLIEHPDSGSRPQELQRSRYRQIVEPPCRVFYRVDGQR
IVLVHVMRWERALRRNRLSR
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0G9C4Q2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2WGS6 |