Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 895899..896461 | Replicon | chromosome |
| Accession | NZ_CP116304 | ||
| Organism | Pseudomonas sp. Q1-7 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | PJW05_RS04080 | Protein ID | WP_271410468.1 |
| Coordinates | 896144..896461 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | PJW05_RS04075 | Protein ID | WP_271410467.1 |
| Coordinates | 895899..896144 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJW05_RS04055 | 891996..893201 | + | 1206 | WP_271410463.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
| PJW05_RS04060 | 893294..894391 | + | 1098 | WP_271410464.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
| PJW05_RS04065 | 894388..895119 | + | 732 | WP_271410465.1 | cobalt-precorrin-6A reductase | - |
| PJW05_RS04070 | 895116..895823 | + | 708 | WP_271410466.1 | (2Fe-2S) ferredoxin domain-containing protein | - |
| PJW05_RS04075 | 895899..896144 | + | 246 | WP_271410467.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PJW05_RS04080 | 896144..896461 | + | 318 | WP_271410468.1 | CcdB family protein | Toxin |
| PJW05_RS04085 | 896458..897228 | - | 771 | WP_271410469.1 | VWA domain-containing protein | - |
| PJW05_RS04090 | 897153..898154 | - | 1002 | WP_271410470.1 | AAA family ATPase | - |
| PJW05_RS04095 | 898671..899756 | + | 1086 | WP_271410471.1 | 3-deoxy-7-phosphoheptulonate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11327.35 Da Isoelectric Point: 4.6684
>T268579 WP_271410468.1 NZ_CP116304:896144-896461 [Pseudomonas sp. Q1-7]
MPQFAVHLNANPATRTTIPYLLDIQSDLIADLGSRVVVPLYTVDVMKGRVLKTLMPLFEVEGNTVVMVTPELAGVSRKAL
GEQVADLSALRNEIIAALDLLITGI
MPQFAVHLNANPATRTTIPYLLDIQSDLIADLGSRVVVPLYTVDVMKGRVLKTLMPLFEVEGNTVVMVTPELAGVSRKAL
GEQVADLSALRNEIIAALDLLITGI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|